Property Summary

Ligand Count 280
NCBI Gene PubMed Count 360
PubMed Score 15129.12
PubTator Score 3409.46

Knowledge Summary


No data available


  Disease (9)

Disease Target Count P-value
pancreatic ductal adenocarcinoma liver metastasis 1962 8.8e-03
nephrosclerosis 333 4.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6
Melanoma 711 0.0 0.5
Disease Target Count Z-score Confidence
Atherosclerosis 291 4.959 2.5
Disease Target Count Z-score Confidence
Thrombophilia 38 5.613 2.8


  Differential Expression (2)

Disease log2 FC p
nephrosclerosis -1.807 4.1e-02
pancreatic ductal adenocarcinoma liver m... -3.582 8.8e-03

Protein-protein Interaction (2)

PDB (32)

Gene RIF (202)

AA Sequence

KYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN                                  771 - 810

Text Mined References (365)

PMID Year Title