Property Summary

NCBI Gene PubMed Count 321
PubMed Score 5412.91
PubTator Score 3409.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (9)

Disease Target Count P-value
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00884308567616562
nephrosclerosis 329 0.0406290236844165
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Atherosclerosis 275 4.7 2.4
Disease Target Count Z-score Confidence
Thrombophilia 37 5.602 2.8
Disease Target Count
Plasminogen deficiency 1

Expression

  Differential Expression (2)

Disease log2 FC p
nephrosclerosis -1.807 0.041
pancreatic ductal adenocarcinoma liver m... -3.582 0.009

Synonym

Accession P00747 Q15146 Q5TEH4 Q6PA00
Symbols

Gene

PLG

PDB

1B2I   1BML   1BUI   1CEA   1CEB   1DDJ   1HPJ   1HPK   1I5K   1KI0   1KRN   1L4D   1L4Z   1PK4   1PKR   1PMK   1QRZ   1RJX   2DOH   2DOI   2KNF   2L0S   2PK4   3UIR   4A5T   4CIK   4DCB   4DUR   4DUU   5HPG  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

Gene RIF (184)

PMID Text
26667841 Plasminogen binding and activation by different glycolytic enzymes of M. pneumoniae play a role in successful colonization of the human respiratory tract.
26637181 reduced proteolytic activity of plasmin on structures of growing thrombi, rather than on complement activation fragments, explains the association of plasminogen deficiency with aHUS.
26359437 These results indicate that FXIIIa activity can be modulated by fibrinolytic enzymes, and suggest that changes in fibrinolytic activity may influence cross-linking of blood proteins.
26070561 These studies demonstrate that GAS virulence can be explained by disparate hPg activation by SK2a and SK2b coupled with the coinherited M-proteins of these strains
26067271 whereas the presence of plasminogen did not affect the factor I cofactor activity of C4BP, the activation of plasminogen by urokinase-type plasminogen activator to active plasmin was significantly augmented in the presence of C4BP.
26029848 PAM activated Plasminogen Glycoform II.
25993872 IGF-II, TGF-beta1 and VEGF-A and its receptor in malignant tumor tissue, as well as increasedplasmin release from proenzyme and MMP-3 activationis apparently associated with the formation of pathogenic mechanism of vasculature development
25971850 Suggest that tubulointerstitial plasmin is associated with inflammation leading to renal fibrosis, and can cause the decline in renal function seen in patients with IgA nephropathy.
25789495 Zinc modulates fibrinolysis by attenuating tPA-mediated plasminogen activation and plasmin-induced fibrin degradation.
25712989 Data show that different subpopulations of platelets harbor plasminogen by diverse mechanisms
More...

AA Sequence

MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFTCRAFQYHSKE      1 - 70
QQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPA     71 - 140
THPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWD    141 - 210
SQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTG    211 - 280
ENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIP    281 - 350
SCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAG    351 - 420
LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYR    421 - 490
GKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQC    491 - 560
AAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRP    561 - 630
SSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECF    631 - 700
ITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKD    701 - 770
KYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN                                  771 - 810
//

Text Mined References (326)

PMID Year Title
26667841 2015 Network of Surface-Displayed Glycolytic Enzymes in Mycoplasma pneumoniae and Their Interactions with Human Plasminogen.
26637181 2015 Minor Role of Plasminogen in Complement Activation on Cell Surfaces.
26627825 2016 Extracellular Fibrinogen-binding Protein (Efb) from Staphylococcus aureus Inhibits the Formation of Platelet-Leukocyte Complexes.
26359437 2015 Coagulation factor XIIIa is inactivated by plasmin.
26070561 2015 Direct Host Plasminogen Binding to Bacterial Surface M-protein in Pattern D Strains of Streptococcus pyogenes Is Required for Activation by Its Natural Coinherited SK2b Protein.
26067271 2015 A Novel Interaction between Complement Inhibitor C4b-binding Protein and Plasminogen That Enhances Plasminogen Activation.
26029848 2015 Preferential Acquisition and Activation of Plasminogen Glycoform II by PAM Positive Group A Streptococcal Isolates.
25993872 2015 [Changes in markers of proliferation, neoangiogenesis and plasminogen activation system in rectal cancer tissue].
25971850 2016 Role of tubulointerstitial plasmin in the progression of IgA nephropathy.
25789495 2015 Zinc delays clot lysis by attenuating plasminogen activation and plasmin-mediated fibrin degradation.
More...