Property Summary

NCBI Gene PubMed Count 35
PubMed Score 230.95
PubTator Score 239.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 7.09990682265285E-27
non-small cell lung cancer 2798 1.0667765797238E-26
breast carcinoma 1614 4.97508504207109E-24
ovarian cancer 8492 2.69494674570801E-12
chronic lymphosyte leukemia 232 1.5550983304014E-10
lung adenocarcinoma 2714 1.56223861992389E-8
tuberculosis 1563 9.99621766981866E-8
intraductal papillary-mucinous adenoma (IPMA) 2956 3.36148067082777E-6
colon cancer 1475 5.74002536384566E-6
psoriasis 6685 1.10500337288418E-5
lung cancer 4473 1.59196902289877E-5
malignant mesothelioma 3163 2.15151931893334E-5
adrenocortical carcinoma 1427 2.42314314061523E-5
invasive ductal carcinoma 2950 6.06765699375623E-5
ductal carcinoma in situ 1745 7.95879222317204E-5
Atopic dermatitis 944 1.84019043202207E-4
limb girdle muscular dystrophy 2A 156 6.57953705566271E-4
Duchenne muscular dystrophy 602 0.00115636648247854
fibroadenoma 557 0.00306015167926483
non-inflammatory breast cancer 208 0.0150625926813763
non primary Sjogren syndrome sicca 840 0.0250089987182307
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0322847061649682
Disease Target Count Z-score Confidence
Obesity 616 4.454 2.2

Expression

  Differential Expression (23)

Synonym

Accession P00746 B4DV76 Q5U5S1 Q86VJ5 Q8N4E0 Q8WZB4
Symbols DF
ADN
PFD
ADIPSIN

Gene

CFD

PDB

2XWB   4D9R   1BIO   1DFP   1DIC   1DST   1DSU   1FDP   1HFD   2XW9   2XWA   4CBN   4CBO  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

Gene RIF (17)

PMID Text
25840635 Overall adipsin levels among male asbestos industry workers were significantly higher than among control subjects.
24995977 Study demonstrates that T2DM patients with beta cell failure are deficient in adipsin.
24958499 Data indicate that a urinary protein, adipsin, was significantly increased in patients with preeclampsia.
24598742 Complement factor D (FD) is activated by its substrate through interactions outside the active site which lock the unbound native state into an ordered inactive conformation via the self-inhibitory loop in FD.
23956345 We demonstrate novel secretion of adipsin and ASP by placental Hofbauer cells.
22930722 Increased activation of the alternative complement pathway in vitreous was controlled by disease stage and genetic variation in the complement pathway, supporting a role for complement activation in macular degeneration disease pathogenesis.
22362762 Anti factor D Fab fragment inhibits FD proteolytic function by interfering with macromolecular substrate access rather than by inhibiting FD catalysis.
22003108 CFD regulates activation of the alternative complement pathway, which is implicated in age related macular degeneration pathogenesis.
21612582 HIV-1 gp120 modulates adipsin expression in human mesenchymal stem cells
21205667 crystal structure of C3bB at 4 A and complex with factor D at 3.5 A; data show how factor B binding to C3b forms open "activation" state of C3bB; Factor D binds open conformation of factor B through a site distant from the catalytic center
More...

AA Sequence

MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLED      1 - 70
AADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDR     71 - 140
DVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSGG    141 - 210
PLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA                               211 - 253
//

Text Mined References (39)

PMID Year Title
25840635 2015 Plasma adipokine levels in Thais.
24995977 2014 Adipsin is an adipokine that improves ? cell function in diabetes.
24958499 2014 Elevation of urinary adipsin in preeclampsia: correlation with urine protein concentration and the potential use for a rapid diagnostic test.
24598742 2014 Ensemble refinement shows conformational flexibility in crystal structures of human complement factor D.
23956345 2013 Elevated fetal adipsin/acylation-stimulating protein (ASP) in obese pregnancy: novel placental secretion via Hofbauer cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22930722 2012 Activation of the alternative complement pathway in vitreous is controlled by genetics in age-related macular degeneration.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
22362762 2012 Inhibiting alternative pathway complement activation by targeting the factor D exosite.
More...