Property Summary

NCBI Gene PubMed Count 332
PubMed Score 4337.61
PubTator Score 2996.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (12)

Disease log2 FC p
tuberculosis 2.100 2.9e-03
atypical teratoid / rhabdoid tumor -1.100 1.3e-05
chronic rhinosinusitis 2.107 4.2e-02
interstitial cystitis 1.300 6.5e-03
lung adenocarcinoma -1.600 1.8e-05
lung cancer -1.900 7.4e-05
lung carcinoma -2.700 2.4e-10
mucosa-associated lymphoid tissue lympho... 3.315 1.9e-02
non-small cell lung cancer -1.173 2.5e-03
osteosarcoma -5.878 1.8e-09
ovarian cancer -2.800 1.9e-03
pituitary cancer -4.100 1.4e-06

Gene RIF (308)

AA Sequence

MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLND      1 - 70
KKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGD     71 - 140
KLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSE    141 - 210
NATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGY    211 - 280
VSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDT    281 - 350
CYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN                  351 - 406
//

Text Mined References (341)

PMID Year Title