Property Summary

NCBI Gene PubMed Count 308
Grant Count 184
R01 Count 107
Funding $34,586,390.68
PubMed Score 4174.58
PubTator Score 2996.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (62)

Disease Z-score Confidence
Anemia 252 5.545 2.8
Autoimmune hemolytic anemia 17 4.877 2.4
Mastitis 48 4.756 2.4
Vascular disease 281 4.647 2.3
Malaria 140 4.394 2.2
Cancer 2,346 4.351 2.2
Kidney disease 396 4.314 2.2
Liver disease 219 4.267 2.1
Endometritis 21 4.262 2.1
Glucosephosphate dehydrogenase deficienc... 15  4.021 2.0
diabetes mellitus 1,663 3.994 2.0
Arthritis 248 3.837 1.9
tuberculosis 1,557 3.763 1.9
Thrombocytopenia 105 3.755 1.9
Vaginal discharge 7 3.699 1.8
Favism 8 3.662 1.8
Pneumonia 133 3.439 1.7
Sleeping sickness 37 3.338 1.7
Bilirubin metabolic disorder 39 3.238 1.6
Inflammatory bowel disease 142 3.21 1.6
Thrombotic thrombocytopenic purpura 14 3.185 1.6
Thalassemia 46 3.173 1.6
Celiac disease 112 3.047 1.5
Obesity 616 3.036 1.5
ANHAPTOGLOBINEMIA 1
Anemia, Sickle Cell 10
Atherosclerosis 275
Autoimmune Diseases 33
Cardiovascular Diseases 50
Complications of Diabetes Mellitus 5
Diabetes Mellitus, Insulin-Dependent 76
Diabetes Mellitus, Non-Insulin-Dependent 157
Diabetic Angiopathies 7
Dyslipidemias 17
Foodborne Disease 1
Genital Neoplasms, Female 1
HIV Infections 100
Hemochromatosis 55
Hemolysis (disorder) 6
Hepatitis B 103
Hepatitis B, Chronic 15
Hepatitis C, Chronic 6
Hypersensitivity 63
Hypertensive disease 193
Leukemia 88
Mammary Neoplasms 410
Myocardial Infarction 126
Pasteurellaceae Infections 3
Pregnancy associated hypertension 2
Retinal detachment 33
Schizophrenia 501
atypical teratoid / rhabdoid tumor 4,369
chronic rhinosinusitis 512
interstitial cystitis 2,299
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
mucosa-associated lymphoid tissue lympho... 480 
non-small cell lung cancer 2,798
osteosarcoma 7,933
ovarian cancer 8,484
pituitary cancer 1,972

Expression

  Differential Expression (12)

Disease log2 FC p
tuberculosis 2.100 0.003
osteosarcoma -5.878 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
non-small cell lung cancer -1.173 0.002
lung cancer -2.400 0.000
interstitial cystitis 1.300 0.006
lung adenocarcinoma -1.600 0.000
lung carcinoma -2.700 0.000
mucosa-associated lymphoid tissue lympho... 3.315 0.019
ovarian cancer -2.800 0.002
pituitary cancer -4.100 0.000
chronic rhinosinusitis 2.107 0.042

Synonym

Accession P00738 B0AZL5 P00737 Q0VAC4 Q0VAC5 Q2PP15 Q3B7J0 Q6LBY9 Q9UC67
Symbols BP
HPA1S
HP2ALPHA2

Gene

HP

PDB

4WJG   4X0L   5HU6  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
488769 other 2 / 0 / 0 Center Based Initiative to identify novel inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): fluorescence-based cell-based quantitative PCR assay to identify inhibitors of LRH-1 target gene expression

Gene RIF (285)

PMID Text
26901066 Recurring exonic deletions in HP likely enhance human health by lowering cholesterol levels in the blood.
26756179 these results demonstrate that sHP is associated with poor prognosis of colorectal cancer patients and that HP promotes colorectal cancer cell invasion.
26503433 The ratio of the fucosylated peaks to their corresponding nonfucosylated forms shows that the fucosylated glycans from haptoglobin are upregulated in the case of hepatocellular carcinoma samples versus cirrhosis samples.
26448449 The bifucosylated tetra-anntenary glycan of haptoglobin was upregulated in hepatocellular carcinoma patients of all etiologies.
26370551 Haptoglobin phenotype is unlikely to be an important modifier of cystic fibrosis phenotype.
26348010 Haptoglobin 2-2 genotype was an independent predictor of cerebral salt wasting syndrome after subarachnoid hemorrhage.
26228081 This study suggests a possible role of haptoglobin phenotype on iron metabolism abnormalities that are observed in Parkinson disease.
26211665 Ovarian cancer cells express both Hp and its receptor CCR2 but only after exposure to ascitic fluid, inducing moderated cell migration; results suggest that Hp-induced changes in the cell morphology, actin cytoskeleton structure, and migration ability of tumor cells, is possibly "preparing" these cells for the potential induction of the metastatic phenotype.
26171400 Hp 2 type is associated with elevated systolic pulmonary arterial pressure and low plasma nitrite levels in hemodialysis patients specifically in the diabetes mellitus state.
26122942 Endothelial dysfunction may be influenced by Hp2/2 genotype in patients with type 1 diabetes with independence of classical CV risk factors.
More...

AA Sequence

MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLND      1 - 70
KKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGD     71 - 140
KLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSE    141 - 210
NATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGY    211 - 280
VSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDT    281 - 350
CYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN                  351 - 406
//

Text Mined References (317)

PMID Year Title
26901066 2016 Recurring exon deletions in the HP (haptoglobin) gene contribute to lower blood cholesterol levels.
26756179 2016 Serum haptoglobin as a novel molecular biomarker predicting colorectal cancer hepatic metastasis.
26503433 2015 ESI-LC-MS Method for Haptoglobin Fucosylation Analysis in Hepatocellular Carcinoma and Liver Cirrhosis.
26448449 2015 Mass Spectrometric N-Glycan Analysis of Haptoglobin from Patient Serum Samples Using a 96-Well Plate Format.
26370551 2015 Lack of Association Between Haptoglobin Phenotype and Cystic Fibrosis Outcomes.
26348010 2016 Haptoglobin 2-2 Genotype Is Associated With Cerebral Salt Wasting Syndrome in Aneurysmal Subarachnoid Hemorrhage.
26228081 2015 Haptoglobin phenotype modifies serum iron levels and the effect of smoking on Parkinson disease risk.
26211665 2015 Haptoglobin and CCR2 receptor expression in ovarian cancer cells that were exposed to ascitic fluid: exploring a new role of haptoglobin in the tumoral microenvironment.
26171400 2015 Interaction between the Haptoglobin 2 Phenotype and Diabetes Mellitus on Systolic Pulmonary Arterial Pressure and Nitric Oxide Bioavailability in Hemodialysis Patients.
26122942 2015 Haptoglobin genotype is associated with increased endothelial dysfunction serum markers in type 1 diabetes.
More...