Property Summary

Ligand Count 2,724
NCBI Gene PubMed Count 1,322
PubMed Score 33691.43
PubTator Score 17181.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Liver disease 237 6.982 3.5
Vitamin K deficiency hemorrhagic disease 11 6.35 3.2
Antiphospholipid syndrome 19 6.222 3.1
Thrombocytopenia 197 5.907 3.0
Blood protein disease 11 5.892 2.9
Protein C deficiency 19 5.84 2.9
Hepatic encephalopathy 27 5.834 2.9
Cancer 2499 5.83 2.9
Cerebrovascular disease 238 5.578 2.8
Atrial Fibrillation 124 5.54 2.8
Portal vein thrombosis 12 5.245 2.6
Esophageal varix 12 5.133 2.6
Hepatitis B 108 5.117 2.6
Coronary artery disease 268 5.11 2.6
Factor VII Deficiency 7 5.034 2.5
Factor X Deficiency 6 5.021 2.5
Hyperhomocysteinemia 37 4.991 2.5
Portal hypertension 20 4.903 2.5
Varicose veins 20 4.9 2.4
Antithrombin III deficiency 14 4.88 2.4
Budd-Chiari syndrome 12 4.877 2.4
Lupus erythematosus 57 4.834 2.4
Hemophilia B 11 4.765 2.4
Kidney disease 430 4.669 2.3
Placental abruption 18 4.643 2.3
Hypertension 396 4.625 2.3
Factor V deficiency 8 4.589 2.3
Factor XI Deficiency 12 4.488 2.2
Anemia 365 4.46 2.2
Von Willebrand's disease 19 4.444 2.2
Cholestasis 155 4.371 2.2
Connective tissue disease 62 4.237 2.1
Hypochondriasis 6 4.225 2.1
Hepatitis A 11 4.199 2.1
Bilirubin metabolic disorder 41 4.161 2.1
Thrombophlebitis 19 4.142 2.1
Peripheral vascular disease 87 4.12 2.1
Hepatitis C 94 4.096 2.0
Lung disease 142 4.001 2.0
diabetes mellitus 1728 3.826 1.9
Factor XIII deficiency 6 3.812 1.9
Purpura 43 3.81 1.9
Hypersplenism 10 3.795 1.9
Peritonitis 43 3.781 1.9
Factor VIII deficiency 10 3.755 1.9
Autoimmune hepatitis 11 3.661 1.8
Endocarditis 19 3.607 1.8
Cholangitis 32 3.483 1.7
Diarrhea 253 3.471 1.7
Vasculitis 80 3.467 1.7
post-thrombotic syndrome 7 3.451 1.7
Atherosclerosis 291 3.429 1.7
Congenital heart disease 93 3.428 1.7
Crimean-Congo hemorrhagic fever 9 3.418 1.7
Congenital afibrinogenemia 11 3.401 1.7
Leukopenia 72 3.392 1.7
Skin disease 66 3.365 1.7
Heart valve disease 39 3.344 1.7
Asthma 385 3.232 1.6
Lactic acidosis 51 3.216 1.6
Factor XII deficiency 13 3.192 1.6
Transient Cerebral Ischemia 25 3.145 1.6
Glanzmann's thrombasthenia 23 3.112 1.6
Congestive heart failure 113 3.093 1.5
Pancreatitis 123 3.021 1.5
Active peptic ulcer disease 3 3.007 1.5
Schistosomiasis 35 3.003 1.5

Expression

PDB (384)

Gene RIF (1274)

AA Sequence

MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLERECVEETCSYEEA      1 - 70
FEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHVNITRSGIECQLWRSRYPHKP     71 - 140
EINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQECSIPVCGQDQVTVAMTPRSEGSSVNLSPPL    141 - 210
EQCVPDRGQQYQGRLAVTTHGLPCLAWASAQAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKP    211 - 280
GDFGYCDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDK    281 - 350
TERELLESYIDGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN    351 - 420
DLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAA    421 - 490
SLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKR    491 - 560
GDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFGE            561 - 622
//

Text Mined References (1340)

PMID Year Title