Property Summary

NCBI Gene PubMed Count 42
Grant Count 38
R01 Count 13
Funding $4,696,918.88
PubMed Score 1681.17
PubTator Score 36.36

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (21)

PMID Text
23005341 High molecular mass complexes are formed with alpha-lactalbumin and alphaB-crystallin, preventing the amorphous aggregation of alpha-lactalbumin.
22735492 analysis of macromolecular crowding on the structural stability of human alpha-lactalbumin
20800603 Observational study of gene-disease association. (HuGE Navigator)
20717070 Data show that alpha-lactalbumin and CD14 form a complex in the gut which alters degradation of CD14, suggesting a mechanism by which this key LPS receptor may remain functional in the neonatal gut.
19968717 The complexes formed by partially folded alpha-lactalbumin with oleic acid display selective apoptotic activity against tumor cells.
19766656 the structural preferences of the alpha-LA molten globule at pH 7 at the level of individual residues were investigated.
19038921 recombinant human alpha-LA was purified from transgenic milk and displayed physicochemical properties similar to its natural counterpart with respect to molecular weight, structure, and regulatory activity for beta-1,4-galactosyltransferase
18939797 alpha-lactalbumin molten globule has even more native-like character than suggested by studies conducted at higher temperature
16851644 Results describe the reaction mechanism and formation of CIDNP (chemically induced dynamic nuclear polarization) in the photoreactions of the dye 2,2'-dipyridyl with non-native states of bovine and human alpha-lactalbumins in aqueous solution.
16121399 Local interactions as well as hydrophobic interactions formed in the molten globule state play an important role in organizing the structure in the transition state and in guiding the subsequent folding of alpha-lactalbumin.
More...

AA Sequence

MRFFVPLFLVGILFPAILAKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYG      1 - 70
LFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCE     71 - 140
KL                                                                        141 - 142
//

Text Mined References (48)

PMID Year Title
24105470 2014 A meta-analysis of genome-wide association studies for adiponectin levels in East Asians identifies a novel locus near WDR11-FGFR2.
23005341 2012 The small heat-shock protein ?B-crystallin uses different mechanisms of chaperone action to prevent the amorphous versus fibrillar aggregation of ?-lactalbumin.
22735492 2012 Effects of macromolecular crowding on the structural stability of human ?-lactalbumin.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20717070 2010 Alpha-lactalbumin in human milk alters the proteolytic degradation of soluble CD14 by forming a complex.
19968717 2010 The oleic acid complexes of proteolytic fragments of alpha-lactalbumin display apoptotic activity.
19766656 2009 The human alpha-lactalbumin molten globule: comparison of structural preferences at pH 2 and pH 7.
19038921 2008 Expression and characterization of bioactive recombinant human alpha-lactalbumin in the milk of transgenic cloned cows.
18939797 2008 Probing the effect of temperature on the backbone dynamics of the human alpha-lactalbumin molten globule.
18780401 2008 Identification of N-linked glycoproteins in human milk by hydrophilic interaction liquid chromatography and mass spectrometry.
More...