Property Summary

NCBI Gene PubMed Count 43
PubMed Score 1695.17
PubTator Score 36.36

Knowledge Summary

Patent

No data available

Gene RIF (22)

AA Sequence

MRFFVPLFLVGILFPAILAKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYG      1 - 70
LFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCE     71 - 140
KL                                                                        141 - 142
//

Text Mined References (49)

PMID Year Title