Property Summary

NCBI Gene PubMed Count 35
PubMed Score 230.09
PubTator Score 186.92

Knowledge Summary

Patent (8,293)

Expression

  Differential Expression (1)

Disease log2 FC p
ependymoma 1.300 2.5e-05

Gene RIF (15)

AA Sequence

MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLE      1 - 70
TVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVD     71 - 140
DNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK                    141 - 194
//

Text Mined References (39)

PMID Year Title