Property Summary

NCBI Gene PubMed Count 35
Grant Count 24
R01 Count 18
Funding $5,440,172
PubMed Score 203.90
PubTator Score 186.92

Knowledge Summary

Patent (8,293)

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.800 0.000

Gene RIF (15)

PMID Text
24495878 Studies indicate that the preferred substrate and phosphate donor of all adenylate kinases are AMP and ATP respectively.
23863634 Dysregulation of AMPK is both a pathogenic factor for these disorders in humans and a target for their prevention and therapy. [Review]
23146316 Ak(1)2-1 phenotype is more frequent in males conceived in the summer-autumn period than in those conceived in winter-spring, and this association depends on maternal Ak(1) phenotype.
22637533 identified hitherto unrecognized soluble forms of AK1 and NTPDase1/CD39 that contribute in the active cycling between the principal platelet-recruiting agent ADP and other circulating nucleotides
22419736 Data indicate that the neuronal adenylate kinase-1 (AK1) is induced by Abeta(42) to increase abnormal tau phosphorylation via AMPK-GSK3beta and contributes to tau-mediated neurodegeneration.
22287021 Our findings suggest a reduced reproductive efficiency of women carrying the Ak(1)2-1 phenotype: this could have practical importance in predicting the probability of reproductive success in couples with RSA
21831515 AK1 phenotypic activity is associated with birth weight and placental weight; these associations are greater in infants born at gestational age greater than 38 weeks.
21457004 The adipokine zinc-alpha2-glycoprotein activates AMP kinase in human primary skeletal muscle cells.
20152999 the correlation between blood glucose and glycated Hb in relation to AK1 and ACP1 polymorphism was studied.
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
More...

AA Sequence

MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLE      1 - 70
TVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVD     71 - 140
DNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK                    141 - 194
//

Text Mined References (39)

PMID Year Title
24495878 2014 The many isoforms of human adenylate kinases.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23863634 2013 AMPK, insulin resistance, and the metabolic syndrome.
23416111 2013 The human adenylate kinase 9 is a nucleoside mono- and diphosphate kinase.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23146316 2013 Ak(1) genetic polymorphism and season of conception.
22637533 2012 Metabolism of circulating ADP in the bloodstream is mediated via integrated actions of soluble adenylate kinase-1 and NTPDase1/CD39 activities.
22419736 2012 Neuropathogenic role of adenylate kinase-1 in A?-mediated tau phosphorylation via AMPK and GSK3?.
22287021 Adenylate kinase genetic polymorphism and spontaneous abortion.
More...