Property Summary

NCBI Gene PubMed Count 90
Grant Count 27
R01 Count 10
Funding $1,648,101.75
PubMed Score 576.26
PubTator Score 243.26

Knowledge Summary

Patent (38,416)

Expression

Gene RIF (45)

PMID Text
26942675 Mitochindrial PGK1 acts as a protein kinase in coordinating glycolysis and the tricarboxylic acid cycle, which is instrumental in cancer metabolism and tumorigenesis.
26510737 In neuroblastoma cells, CAIX and PGK1 expression is up regulated under hypoxia and correlates with response to targeted anti-proliferative treatment.
26396085 Retinal dystrophy may be one of the clinical manifestations of phosphoglycerate kinase deficiency.
26356530 PI3K/AKT/mTOR pathway regulates HDAC3 S424 phosphorylation, which promotes HDAC3-PGK1 interaction and PGK1 K220 deacetylation
25867275 Results show that PGK1 mRNA and protein expression were significantly increased in breast cancer tissues and can be considered as a prognostic biomarker of chemoresistance to paclitaxel treatment in breast cancer.
25175369 Suppression of PGK1 enhanced the radiosensitivity of U251 xenografts and suggest that PGK1 may serve as a useful target in the treatment of radioresistant glioma.
24934115 Phosphoglycerate kinase deficiency due to a novel mutation (c. 1180A>G) manifesting as chronic hemolytic anemia in a Japanese boy.
24838780 mutations associated with hPGK1 deficiency lead to increased aggregation and proteolysis rates in vitro and inside cells due to protein thermodynamic destabilization
24721582 different factors contributing to hPGK1 thermodynamic and kinetic stability
24376734 PGK1 appears to play an important role for neuroblastoma
More...

AA Sequence

MSLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGRPDGV      1 - 70
PMPDKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENLRFHVEEEGKGKDASGNKV     71 - 140
KAEPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNYFAKALESPERPFLA    141 - 210
ILGGAKVADKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKI    211 - 280
TLPVDFVTADKFDENAKTGQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR    281 - 350
GTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI       351 - 417
//

Text Mined References (104)

PMID Year Title
26942675 2016 Mitochondria-Translocated PGK1 Functions as a Protein Kinase to Coordinate Glycolysis and the TCA Cycle in Tumorigenesis.
26677959 2016 Characteristics of testis-specific phosphoglycerate kinase 2 and its association with human sperm quality.
26510737 2016 Influence of hypoxia-dependent factors on the progression of neuroblastoma.
26396085 2015 A negative waveform in the scotopic response in a patient with phosphoglycerate kinase deficiency: a visual electrophysiology report.
26356530 2015 Insulin and mTOR Pathway Regulate HDAC3-Mediated Deacetylation and Activation of PGK1.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25867275 2015 Phosphoglycerate kinase-1 is a predictor of poor survival and a novel prognostic biomarker of chemoresistance to paclitaxel treatment in breast cancer.
25204797 2014 Flotillin-1 facilitates toll-like receptor 3 signaling in human endothelial cells.
25175369 2014 Downregulation of phosphoglycerate kinase 1 by shRNA sensitizes U251 xenografts to radiotherapy.
24934115 2014 Phosphoglycerate kinase deficiency due to a novel mutation (c. 1180A>G) manifesting as chronic hemolytic anemia in a Japanese boy.
More...