Property Summary

NCBI Gene PubMed Count 90
PubMed Score 576.26
PubTator Score 243.26

Knowledge Summary

Patent (38,416)

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
breast carcinoma 1614 1.04019136027882E-25
non-small cell lung cancer 2798 1.83553831290976E-16
lung adenocarcinoma 2714 2.44500576324581E-11
psoriasis 6685 5.97217808911597E-5
ovarian cancer 8492 7.20316522388261E-5
osteosarcoma 7933 3.84628322492957E-4
Multiple myeloma 1328 4.81696595982657E-4
posterior fossa group A ependymoma 1511 5.40184323575284E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 5.70389191499117E-4
invasive ductal carcinoma 2950 9.25816812288487E-4
Pick disease 1893 0.00107818642864354
ductal carcinoma in situ 1745 0.00111416905831652
acute quadriplegic myopathy 1157 0.00112174469158108
cystic fibrosis 1670 0.00196630611670682
primary pancreatic ductal adenocarcinoma 1271 0.00594359697034564
dermatomyositis 967 0.0112801322084796
glioblastoma 5572 0.01372247664135
Waldenstrons macroglobulinemia 765 0.0180635407872464
adrenocortical carcinoma 1427 0.0187313211891219
pancreatic cancer 2300 0.0223176865146533
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0282273478002597
astrocytic glioma 2241 0.0334756518515351
Breast cancer 3099 0.0397375210278025
Disease Target Count Z-score Confidence
Congenital hemolytic anemia 31 0.0 4.0

Expression

Synonym

Accession P00558 A8K4W6 B7Z7A9 Q5J7W1 Q6IBT6 Q8NI87
Symbols PGKA
MIG10
HEL-S-68p

Gene

PDB

2WZB   2WZC   2WZD   2X13   2X14   2X15   2XE6   2XE7   2XE8   2Y3I   2YBE   2ZGV   3C39   3C3A   3C3B   3C3C   3ZOZ   4AXX   4O33  

  Ortholog (15)

Species Source
Chimp OMA Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (45)

PMID Text
26942675 Mitochindrial PGK1 acts as a protein kinase in coordinating glycolysis and the tricarboxylic acid cycle, which is instrumental in cancer metabolism and tumorigenesis.
26510737 In neuroblastoma cells, CAIX and PGK1 expression is up regulated under hypoxia and correlates with response to targeted anti-proliferative treatment.
26396085 Retinal dystrophy may be one of the clinical manifestations of phosphoglycerate kinase deficiency.
26356530 PI3K/AKT/mTOR pathway regulates HDAC3 S424 phosphorylation, which promotes HDAC3-PGK1 interaction and PGK1 K220 deacetylation
25867275 Results show that PGK1 mRNA and protein expression were significantly increased in breast cancer tissues and can be considered as a prognostic biomarker of chemoresistance to paclitaxel treatment in breast cancer.
25175369 Suppression of PGK1 enhanced the radiosensitivity of U251 xenografts and suggest that PGK1 may serve as a useful target in the treatment of radioresistant glioma.
24934115 Phosphoglycerate kinase deficiency due to a novel mutation (c. 1180A>G) manifesting as chronic hemolytic anemia in a Japanese boy.
24838780 mutations associated with hPGK1 deficiency lead to increased aggregation and proteolysis rates in vitro and inside cells due to protein thermodynamic destabilization
24721582 different factors contributing to hPGK1 thermodynamic and kinetic stability
24376734 PGK1 appears to play an important role for neuroblastoma
More...

AA Sequence

MSLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGRPDGV      1 - 70
PMPDKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENLRFHVEEEGKGKDASGNKV     71 - 140
KAEPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNYFAKALESPERPFLA    141 - 210
ILGGAKVADKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKI    211 - 280
TLPVDFVTADKFDENAKTGQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR    281 - 350
GTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI       351 - 417
//

Text Mined References (104)

PMID Year Title
26942675 2016 Mitochondria-Translocated PGK1 Functions as a Protein Kinase to Coordinate Glycolysis and the TCA Cycle in Tumorigenesis.
26677959 2016 Characteristics of testis-specific phosphoglycerate kinase 2 and its association with human sperm quality.
26510737 2016 Influence of hypoxia-dependent factors on the progression of neuroblastoma.
26396085 2015 A negative waveform in the scotopic response in a patient with phosphoglycerate kinase deficiency: a visual electrophysiology report.
26356530 2015 Insulin and mTOR Pathway Regulate HDAC3-Mediated Deacetylation and Activation of PGK1.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25867275 2015 Phosphoglycerate kinase-1 is a predictor of poor survival and a novel prognostic biomarker of chemoresistance to paclitaxel treatment in breast cancer.
25204797 2014 Flotillin-1 facilitates toll-like receptor 3 signaling in human endothelial cells.
25175369 2014 Downregulation of phosphoglycerate kinase 1 by shRNA sensitizes U251 xenografts to radiotherapy.
24934115 2014 Phosphoglycerate kinase deficiency due to a novel mutation (c. 1180A>G) manifesting as chronic hemolytic anemia in a Japanese boy.
More...