Property Summary

Ligand Count 8
NCBI Gene PubMed Count 94
PubMed Score 602.54
PubTator Score 243.26

Knowledge Summary

Patent (38,416)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Congenital hemolytic anemia 32 0.0 4.0

Expression

  Differential Expression (23)

Disease log2 FC p
acute quadriplegic myopathy 1.050 1.1e-03
adrenocortical carcinoma 1.520 9.8e-03
astrocytic glioma -1.200 3.3e-02
Breast cancer 2.400 4.0e-02
breast carcinoma 1.100 2.8e-08
cystic fibrosis 1.050 2.0e-03
dermatomyositis -1.600 1.1e-02
ductal carcinoma in situ 1.100 1.1e-03
glioblastoma 1.600 2.1e-02
intraductal papillary-mucinous carcinoma... 1.300 1.8e-02
intraductal papillary-mucinous neoplasm ... 1.700 2.3e-02
invasive ductal carcinoma 1.100 6.4e-04
lung adenocarcinoma 1.843 2.4e-11
Multiple myeloma 1.914 4.8e-04
non-small cell lung cancer 1.301 1.9e-18
osteosarcoma 1.142 9.4e-03
ovarian cancer -1.200 1.9e-02
pancreatic cancer 1.300 2.3e-06
pancreatic ductal adenocarcinoma liver m... 1.368 3.1e-02
Pick disease -1.200 1.8e-04
posterior fossa group A ependymoma 1.200 5.4e-04
psoriasis 1.600 6.0e-05
Waldenstrons macroglobulinemia 1.238 1.5e-02

PDB (19)

Gene RIF (50)

AA Sequence

MSLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGRPDGV      1 - 70
PMPDKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENLRFHVEEEGKGKDASGNKV     71 - 140
KAEPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNYFAKALESPERPFLA    141 - 210
ILGGAKVADKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKI    211 - 280
TLPVDFVTADKFDENAKTGQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR    281 - 350
GTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI       351 - 417
//

Text Mined References (108)

PMID Year Title