Property Summary

NCBI Gene PubMed Count 28
Grant Count 79
R01 Count 38
Funding $20,119,777.74
PubMed Score 11.31
PubTator Score 517.27

Knowledge Summary

Patent (27,926)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cancer 2,346 4.0

Synonym

Accession P00540 Q3KPG9 Q3KPH0
Symbols MSV

Gene

MOS

Gene RIF (11)

PMID Text
25512530 approach identified 18 kinase and kinase-related genes whose overexpression can substitute for EGFR in EGFR-dependent PC9 cells, and these genes include seven of nine Src family kinase genes, FGFR1, FGFR2, ITK, NTRK1, NTRK2, MOS, MST1R, and RAF1.
23595635 High methylation level in MOS is associated with intestinal metaplasia.
22252584 among the candidate genes, DNA methylation of MOS may reflect the duration of H. pylori exposure and may be a marker for the development of gastric cancer.
20546612 Observational study of gene-disease association. (HuGE Navigator)
20186124 In the absence of p53, Mos knockdown prevents multipolar mitoses and exerts genome-stabilizing effects.
18550795 Cdc2 and Mos regulate Emi2 stability to promote the meiosis I-meiosis II transition
18246541 Mos 3' UTR regulatory differences underlie species-specific temporal patterns of Mos mRNA cytoplasmic polyadenylation and translational recruitment during oocyte maturation.
18187620 Knockdown of v-mos Moloney murine sarcoma viral oncogene homolog (MOS) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17410130 These results clarify the direct link of the classical Mos-MAPK (mitogen-activated protein kinase) pathway to Erp1 in meiotic arrest of vertebrate oocytes.
16401344 multiple meiotic genes are aberrantly activated during mitotic catastrophe in p53 mutated lymphoma cells after irradiation; the coordinated expression of MOS and REC8 regulate the extent of arrested mitoses and polyploidy
More...

AA Sequence

MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATLPRAPRLPRRLAWCSIDWEQVCLLQRLGAGG      1 - 70
FGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRVVAASTRTPAGSNSLGTIIME     71 - 140
FGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLKYSLDVVNGLLFLHSQSIVHLDLKPANILIS    141 - 210
EQDVCKISDFGCSEKLEDLLCFQTPSYPLGGTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYS    211 - 280
GERQHILYAVVAYDLRPSLSAAVFEDSLPGQRLGDVIQRCWRPSAAQRPSARLLLVDLTSLKAELG        281 - 346
//

Text Mined References (29)

PMID Year Title
25512530 2014 Genetic modifiers of EGFR dependence in non-small cell lung cancer.
25416956 2014 A proteome-scale map of the human interactome network.
23595635 2013 Changes in aberrant DNA methylation after Helicobacter pylori eradication: a long-term follow-up study.
22252584 2012 Prediction of the risk for gastric cancer using candidate methylation markers in the non-neoplastic gastric mucosae.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20186124 2010 Multipolar mitosis of tetraploid cells: inhibition by p53 and dependency on Mos.
18550795 2008 Cdc2 and Mos regulate Emi2 stability to promote the meiosis I-meiosis II transition.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18246541 2008 Mos 3' UTR regulatory differences underlie species-specific temporal patterns of Mos mRNA cytoplasmic polyadenylation and translational recruitment during oocyte maturation.
More...