Property Summary

Ligand Count 618
NCBI Gene PubMed Count 663
PubMed Score 3418.51
PubTator Score 4611.85

Knowledge Summary

Patent (329,475)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Cancer 2499 6.589 3.3
Disease Target Count Z-score Confidence
Polycythemia vera 27 5.28 2.6
Hypereosinophilic syndrome 71 3.149 1.6

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytoma 2.100 6.6e-04
atypical teratoid / rhabdoid tumor 1.100 2.9e-05
Down syndrome 1.200 5.3e-04
ependymoma 1.200 1.5e-02
group 3 medulloblastoma 1.100 1.9e-04
juvenile dermatomyositis 1.147 9.4e-13
osteosarcoma 1.123 1.8e-02
ovarian cancer -1.400 1.2e-06
pancreatic cancer 1.100 3.3e-02
primary pancreatic ductal adenocarcinoma 1.164 4.8e-02
tuberculosis -1.200 1.9e-07

Synonym

Accession P00519 A3KFJ3 Q13869 Q13870 Q16133 Q17R61 Q45F09
Symbols ABL
JTK7
p150
c-ABL
v-abl
CHDSKM
c-ABL1
bcr/abl

Gene

PDB

4J9D   4J9F   5DC0   5DC4   5DC9   1AB2   1ABL   1AWO   1BBZ   1JU5   1OPL   1ZZP   2ABL   2E2B   2F4J   2FO0   2G1T   2G2F   2G2H   2G2I   2GQG   2HIW   2HYY   2HZ0   2HZ4   2HZI   2O88   2V7A   3CS9   3EG0   3EG1   3EG2   3EG3   3EGU   3K2M   3PYY   3QRI   3QRJ   3QRK   3T04   3UE4   3UYO   4J9B   4J9C   4J9E   4J9G   4J9H   4J9I   4JJB   4JJC   4JJD   4TWP   4WA9   4XEY   4YC8   4ZOG   5HU9   5MO4   5OAZ   6AMV   6AMW  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (465)

AA Sequence

MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALY      1 - 70
DFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYL     71 - 140
LSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLI    141 - 210
TTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEV    211 - 280
EEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSA    281 - 350
MEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKS    351 - 420
DVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIH    421 - 490
QAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAEHRDTTDVPEMPHSKGQGESD    491 - 560
PLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPER    561 - 630
RGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLAT    631 - 700
GEEEGGGSSSKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGEN    701 - 770
RSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGS    771 - 840
ALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPPPPPAASAGKA    841 - 910
GGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVLPATPKPQSAKPSGTPISPAP    911 - 980
VPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALCLAISRNSEQM    981 - 1050
ASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSS   1051 - 1120
VKEISDIVQR                                                               1121 - 1130
//

Text Mined References (696)

PMID Year Title