Property Summary

NCBI Gene PubMed Count 629
Grant Count 766
R01 Count 516
Funding $68,535,469.65
PubMed Score 3222.22
PubTator Score 4611.85

Knowledge Summary

Patent (329,475)

Expression

  Differential Expression (11)

Disease log2 FC p
ependymoma 1.200 0.015
osteosarcoma 1.123 0.018
astrocytoma 2.100 0.001
atypical teratoid / rhabdoid tumor 1.100 0.000
group 4 medulloblastoma 1.500 0.000
juvenile dermatomyositis 1.147 0.000
tuberculosis -1.200 0.000
primary pancreatic ductal adenocarcinoma 1.164 0.048
ovarian cancer 2.000 0.000
Down syndrome 1.200 0.001
pancreatic cancer 1.100 0.033

Synonym

Accession P00519 A3KFJ3 Q13869 Q13870 Q16133 Q17R61 Q45F09
Symbols ABL
JTK7
p150
c-ABL
v-abl
c-ABL1
bcr/abl

Gene

PDB

4J9D   4J9F   5DC0   5DC4   5DC9   1AB2   1ABL   1AWO   1BBZ   1JU5   1OPL   1ZZP   2ABL   2E2B   2F4J   2FO0   2G1T   2G2F   2G2H   2G2I   2GQG   2HIW   2HYY   2HZ0   2HZ4   2HZI   2O88   2V7A   3CS9   3EG0   3EG1   3EG2   3EG3   3EGU   3K2M   3PYY   3QRI   3QRJ   3QRK   3T04   3UE4   3UYO   4J9B   4J9C   4J9E   4J9G   4J9H   4J9I   4JJB   4JJC   4JJD   4TWP   4WA9   4XEY   4YC8   4ZOG   5HU9  

  TechDev Info (2)

Gary Johnson Kinome profile via MIB/MS Technology
Michael McManus Genetic interaction screen

 GWAS Trait (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
602398 confirmatory 20 / 0 / 3 Late stage assay for the probe development effort to identify inhibitors of the interaction of the Ras and Rab interactor 1 protein (Rin1) and the c-abl oncogene 1, non-receptor tyrosine kinase (Abl): TRFRET-based biochemical dose response assay for inhibitors of Rin1-Abl interactions

Gene RIF (438)

PMID Text
27273956 BCR-ABL1 transcript types found in Syria were similar to that of Indian Far-Eastern, African or European populations. The M-BCR rearrangement types were not dependent on white blood count, platelet count, hemoglobin level or gender of the patients.
27018250 mammalian c-Abl plays an important role in steroid hormone receptor-mediated transcription by regulating RBM39
26838548 ABL kinases promote breast cancer osteolytic metastasis by modulating tumor-bone interactions through TAZ and STAT5 signaling.
26831735 Data suggest elevated interleukin-1beta secretion from tyrosine kinase inhibitor- (TKI-)resistant chronic myeloid leukemia (CML) cells contributes to TKI/imatinib resistance via promotion of cell viability/migration; cells used lack BCR-ABL mutation.
26721204 Blockade of the interaction between Bcr-Abl and PTB1B by small molecule SBF-1 to overcomes imatinib-resistance of K562 cells.
26607903 Suggest that AIC-47 in combination with imatinib strengthened the attack on cancer energy metabolism in BCR-ABL-harboring leukemic cells.
26429164 loss of expression or even the down-regulation of c-abl, but not WYHAZ, is a fundamental event that leads to genesis and progression of tumors
26429162 analysis of WT1 and M-BCR-ABL expressions in chronic myeloid leukemia reveals that high WT1 expression in CML patients is detected especially in the advanced stages of the disease
26295305 Identify a novel BCR-ABL/IkappaBalpha/p53 network, whereby BCR-ABL functionally inactivates a key tumor suppressor in chronic myeloid leukemia.
26291129 demonstrated that depletion of endogenous MAPK15 expression inhibited BCR-ABL1-dependent cell proliferation
More...

AA Sequence

MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSENDPNLFVALY      1 - 70
DFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYL     71 - 140
LSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLI    141 - 210
TTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEV    211 - 280
EEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSA    281 - 350
MEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKS    351 - 420
DVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIH    421 - 490
QAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAEHRDTTDVPEMPHSKGQGESD    491 - 560
PLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGQPER    561 - 630
RGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLAT    631 - 700
GEEEGGGSSSKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGEN    701 - 770
RSDQVTRGTVTPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGS    771 - 840
ALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPPPPPAASAGKA    841 - 910
GGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVLPATPKPQSAKPSGTPISPAP    911 - 980
VPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPERIASGAITKGVVLDSTEALCLAISRNSEQM    981 - 1050
ASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSS   1051 - 1120
VKEISDIVQR                                                               1121 - 1130
//

Text Mined References (662)

PMID Year Title
27273956 Correlation of p210 BCR-ABL transcript variants with clinical, parameters and disease outcome in 45 chronic myeloid leukemia patients.
27018250 2016 Functional interaction between nonreceptor tyrosine kinase c-Abl and SR-Rich protein RBM39.
26838548 2016 ABL kinases promote breast cancer osteolytic metastasis by modulating tumor-bone interactions through TAZ and STAT5 signaling.
26831735 2016 Secretion of IL-1? from imatinib-resistant chronic myeloid leukemia cells contributes to BCR-ABL mutation-independent imatinib resistance.
26721204 2016 Blockade of the interaction between Bcr-Abl and PTB1B by small molecule SBF-1 to overcome imatinib-resistance of chronic myeloid leukemia cells.
26607903 2016 Perturbation of energy metabolism by fatty-acid derivative AIC-47 and imatinib in BCR-ABL-harboring leukemic cells.
26429164 2015 c-abl and YWHAZ gene expression in gastric cancer.
26429162 2015 Real-time quantitative PCR detection of WT1 and M-BCR-ABL expressions in chronic myeloid leukemia.
26295305 2015 Non genomic loss of function of tumor suppressors in CML: BCR-ABL promotes I?B? mediated p53 nuclear exclusion.
26291129 2015 MAPK15 mediates BCR-ABL1-induced autophagy and regulates oncogene-dependent cell proliferation and tumor formation.
More...