Property Summary

NCBI Gene PubMed Count 42
PubMed Score 1435.01
PubTator Score 188.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ductal carcinoma in situ 1.100 2.4e-03
glioblastoma -1.100 1.1e-04
invasive ductal carcinoma 1.400 7.2e-03
lung cancer 1.100 4.9e-03
ovarian cancer 1.400 4.0e-04
psoriasis 1.100 4.6e-04

Gene RIF (9)

AA Sequence

MALLHSGRVLPGIAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDD      1 - 70
NGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRI     71 - 140
GASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLH    141 - 210
ACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKN    211 - 280
MGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADR    281 - 350
IIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGY    351 - 420
LAHAIHQVTK                                                                421 - 430
//

Text Mined References (49)

PMID Year Title