Property Summary

NCBI Gene PubMed Count 41
Grant Count 198
R01 Count 115
Funding $17,273,305.15
PubMed Score 1416.89
PubTator Score 188.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.100 0.000
glioblastoma -1.100 0.000
lung cancer 1.500 0.000
ductal carcinoma in situ 1.100 0.002
invasive ductal carcinoma 1.400 0.007
ovarian cancer 1.400 0.000

Synonym

Accession P00505 B4DJA6 E7ERW2 Q53FL3 Q9BWA3 mAspAT
Symbols KAT4
KATIV
KYAT4
mitAAT

Gene

PDB

5AX8  

 GWAS Trait (1)

Gene RIF (8)

PMID Text
26791191 Data suggest that, in context of abnormal hepatic lipid accumulation in nonalcoholic fatty liver disease, circulating GOT2 rises due to up-regulation of hepatic expression of GOT2 associated with greater gluconeogenesis and insulin resistance.
25755250 A previously unknown mechanism by which GOT2 acetylation stimulates the malate-aspartate NADH shuttle activity and oxidative protection.
24937540 High glucose infusion was associated with increased expression of higher plasma membrane-associated fatty acid-binding protein (FABPpm).
22713574 The lipid binding process in L-FABP is associated with backbone dynamics.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
17877759 PTLP activity is positively associated with serum ALT1, GOT1 and GOT2 in type 2 diabetes mellitus and metabolic syndrome.
17728674 Frequency of polymorphism are similar in control groups and schizophrenics.

AA Sequence

MALLHSGRVLPGIAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDD      1 - 70
NGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRI     71 - 140
GASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLH    141 - 210
ACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKN    211 - 280
MGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADR    281 - 350
IIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGY    351 - 420
LAHAIHQVTK                                                                421 - 430
//

Text Mined References (47)

PMID Year Title
26791191 2016 Serum aminotransferases in nonalcoholic fatty liver disease are a signature of liver metabolic perturbations at the amino acid and Krebs cycle level.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25755250 2015 SIRT3-dependent GOT2 acetylation status affects the malate-aspartate NADH shuttle activity and pancreatic tumor growth.
24937540 2014 Association between expression of FABPpm in skeletal muscle and insulin sensitivity in intramyocellular lipid-accumulated nonobese men.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22713574 2012 Solution structure and backbone dynamics of human liver fatty acid binding protein: fatty acid binding revisited.
More...