Property Summary

Ligand Count 35
NCBI Gene PubMed Count 154
PubMed Score 2350.66
PubTator Score 1925.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Lesch-Nyhan syndrome 12 8.639 4.0
Hyperuricemia 47 6.026 3.0
Gout, HPRT-Related 2 0.0 0.0

Expression

  Differential Expression (27)

Disease log2 FC p
acute quadriplegic myopathy 1.365 7.2e-05
adult high grade glioma -1.800 6.6e-05
Amyotrophic lateral sclerosis 1.089 4.7e-05
astrocytic glioma -3.000 2.3e-03
Astrocytoma, Pilocytic -1.900 2.8e-08
atypical teratoid / rhabdoid tumor -2.300 7.8e-07
Breast cancer 2.500 4.3e-02
breast carcinoma 1.200 1.3e-03
dermatomyositis 1.100 1.3e-02
ductal carcinoma in situ 1.100 1.3e-03
ependymoma -2.700 1.0e-02
glioblastoma -1.300 3.1e-04
group 4 medulloblastoma -1.100 2.6e-03
invasive ductal carcinoma 1.300 2.1e-03
juvenile dermatomyositis 1.117 1.2e-08
lung adenocarcinoma 1.100 5.7e-08
lung cancer 2.400 1.1e-04
medulloblastoma, large-cell -1.300 3.7e-04
Multiple myeloma 2.036 4.3e-04
nasopharyngeal carcinoma 1.300 5.3e-05
non-small cell lung cancer 1.271 5.0e-19
oligodendroglioma -2.300 1.9e-02
ovarian cancer 2.200 1.1e-04
Pick disease -1.600 1.6e-02
primitive neuroectodermal tumor -1.500 2.0e-03
psoriasis 1.100 1.6e-04
Waldenstrons macroglobulinemia 2.252 7.8e-03

Protein-protein Interaction (1)

Gene RIF (86)

AA Sequence

MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKG      1 - 70
GYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTG     71 - 140
KTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISE    141 - 210
TGKAKYKA                                                                  211 - 218
//

Text Mined References (162)

PMID Year Title