Property Summary

NCBI Gene PubMed Count 144
PubMed Score 2326.79
PubTator Score 1925.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count
Gout, HPRT-Related 2
Disease Target Count P-value
non-small cell lung cancer 2798 5.04547206633652E-19
juvenile dermatomyositis 1189 1.18734150683178E-8
pilocytic astrocytoma 3086 2.07198357601403E-8
atypical teratoid / rhabdoid tumor 4369 7.77587931372145E-7
lung adenocarcinoma 2714 1.32167058081478E-5
Amyotrophic Lateral Sclerosis 432 4.67951626399856E-5
nasopharyngeal carcinoma 1056 5.30307404397135E-5
adult high grade glioma 2148 6.62637186326459E-5
acute quadriplegic myopathy 1157 7.22877237020507E-5
medulloblastoma 1524 1.04589676350112E-4
ovarian cancer 8492 1.09133446268235E-4
lung cancer 4473 1.10833930308424E-4
psoriasis 6685 1.60691290061715E-4
medulloblastoma, large-cell 6234 3.7017604808666E-4
Multiple myeloma 1328 4.2946693377028E-4
breast carcinoma 1614 0.00126754875903529
ductal carcinoma in situ 1745 0.00129167593230002
glioblastoma 5572 0.00144263639405565
primitive neuroectodermal tumor 3031 0.00203269332054557
invasive ductal carcinoma 2950 0.00207614529941692
astrocytic glioma 2241 0.00228593333518079
Waldenstrons macroglobulinemia 765 0.00777267102578588
ependymoma 2514 0.0104269293228644
dermatomyositis 967 0.0134090705480492
Pick disease 1893 0.0157857647591217
oligodendroglioma 2849 0.0191065428734775
Breast cancer 3099 0.0434019724903514
Disease Target Count Z-score Confidence
Gout 93 5.855 2.9
Disease Target Count
Gout HPRT-related 1

Expression

  Differential Expression (27)

Disease log2 FC p
Waldenstrons macroglobulinemia 2.252 0.008
Multiple myeloma 2.036 0.000
astrocytic glioma -3.000 0.002
ependymoma -2.700 0.010
oligodendroglioma -2.300 0.019
psoriasis 1.100 0.000
glioblastoma -1.700 0.001
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma -1.500 0.000
medulloblastoma, large-cell -1.300 0.000
primitive neuroectodermal tumor -1.500 0.002
juvenile dermatomyositis 1.117 0.000
Amyotrophic Lateral Sclerosis 1.089 0.000
acute quadriplegic myopathy 1.365 0.000
non-small cell lung cancer 1.271 0.000
lung cancer 2.400 0.000
breast carcinoma 1.200 0.001
Breast cancer 2.500 0.043
adult high grade glioma -1.800 0.000
pilocytic astrocytoma -1.900 0.000
lung adenocarcinoma 1.156 0.000
nasopharyngeal carcinoma 1.300 0.000
Pick disease -1.600 0.016
ductal carcinoma in situ 1.100 0.001
invasive ductal carcinoma 1.300 0.002
ovarian cancer 2.200 0.000
dermatomyositis 1.100 0.013

Synonym

Accession P00492 A6NHF0 B2R8M9 HGPRT
Symbols HPRT
HGPRT

Gene

PANTHER Protein Class (2)

PDB

1BZY   1D6N   1HMP   1Z7G   2VFA   3GEP   3GGC   3GGJ   4IJQ   4KN6   4RAB   4RAC   4RAD   4RAN   4RAO   4RAQ   5BRN   5BSK  

  Ortholog (10)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (78)

PMID Text
26204901 HPRT gene mutation assay demonstrated that surface chemical composition plays a significant role in silver nanoparticle toxicity.
26050630 Pseudogene-free amplification of HPRT1 in quantitative reverse transcriptase polymerase chain reaction.
25965333 Lesch-Nyhan Syndrome in a Family with a Deletion Followed by an Insertion within the HPRT1 Gene
25914368 HPRT mutations are not increased by systemic depleted uranium exposure.
25612837 A highly significant correlation between six metabolites and the HGprt deficiency was established, each of them providing an easily measurable marker of the disease.
25136576 13 novel mutations in Saudi Arabian HPRT-related hyperuricemia patients manifesting different levels of uric acid.
24940672 HPRT1 mutations in new Japanese families and PRPP concentration
24075303 Our studies suggest that the p.Leu68Pro mutation has a strong impact on PRPP binding and on stability of the active conformation.
23907213 In the study presented here, for the first time T-705/favipiravir absolutely depends on the cellular HGPRT enzyme to exert its anti-influenza virus activity in mammalian cells.
23728617 Treatment of human primary astrocytes with HIV-1 Vpr downregulates expression of eleven genes, BNIP3, CYGB, DUOX2, DUSP1, FOXM1, GAPDH, HPRT1, MT3, MTL5, PTGS2, and SCARA3
More...

AA Sequence

MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGHHIVALCVLKG      1 - 70
GYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTG     71 - 140
KTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISE    141 - 210
TGKAKYKA                                                                  211 - 218
//

Text Mined References (151)

PMID Year Title
26204901 2015 Impact of nanosilver on various DNA lesions and HPRT gene mutations - effects of charge and surface coating.
26072972 2015 TL1A as a Potential Local Inducer of IL17A Expression in Colon Mucosa of Inflammatory Bowel Disease Patients.
26050630 2015 Pseudogene-free amplification of HPRT1 in quantitative reverse transcriptase polymerase chain reaction.
25965333 2015 Lesch-Nyhan Syndrome in a Family with a Deletion Followed by an Insertion within the HPRT1 Gene.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25914368 2015 Mutagenicity monitoring following battlefield exposures: Longitudinal study of HPRT mutations in Gulf War I veterans exposed to depleted uranium.
25833399 2015 Placental melatonin system is present throughout pregnancy and regulates villous trophoblast differentiation.
25612837 2015 New biomarkers for early diagnosis of Lesch-Nyhan disease revealed by metabolic analysis on a large cohort of patients.
25416956 2014 A proteome-scale map of the human interactome network.
25136576 2014 Novel hypoxanthine guanine phosphoribosyltransferase gene mutations in Saudi Arabian hyperuricemia patients.
More...