Property Summary

NCBI Gene PubMed Count 61
Grant Count 106
R01 Count 39
Funding $36,547,014.2
PubMed Score 476.31
PubTator Score 350.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Chronic Lymphocytic Leukemia -1.154 0.000
psoriasis 2.100 0.000
cutaneous lupus erythematosus 1.100 0.004
osteosarcoma -2.258 0.000
Atopic dermatitis 1.200 0.000
tuberculosis and treatment for 6 months -2.100 0.000
primary pancreatic ductal adenocarcinoma 1.954 0.004
pancreatic cancer 1.700 0.005
interstitial cystitis 1.300 0.000
group 3 medulloblastoma -1.100 0.005
Breast cancer 1.900 0.000
lung carcinoma -1.100 0.000
breast carcinoma 1.100 0.000
ductal carcinoma in situ 1.200 0.001
invasive ductal carcinoma 1.500 0.000
ulcerative colitis 1.100 0.000
ovarian cancer 1.900 0.001

Synonym

Accession P00491 B2R8S5 D3DS00 Q15160 Q5PZ03 PNP
Symbols NP
PUNP
PRO1837

Gene

PNP

PANTHER Protein Class (2)

PDB

1M73   1PF7   1PWY   1RCT   1RFG   1RR6   1RSZ   1RT9   1ULA   1ULB   1V2H   1V3Q   1V41   1V45   1YRY   2A0W   2A0X   2A0Y   2OC4   2OC9   2ON6   2Q7O   3BGS   3D1V   3GB9   3GGS   3INY   3K8O   3K8Q   3PHB   4EAR   4EB8   4ECE   4GKA   5ETJ  

Gene RIF (30)

PMID Text
26985580 Data (including data from empirical valence bond/molecular dynamic simulations) suggest that PNP substrate specificity for inosine and guanosine is a direct result of electrostatic preorganization energy along the reaction coordinate.
26305965 Data show that [15N, 2H]His8-purine nucleoside phosphorylase (PNP) had reduced catalytic site chemistry larger than proportional to the enzymatic mass difference.
25625196 the binding mechanism of a transition state analogue (DADMe-immucillin-H) to the purine nucleoside phosphorylase (PNP) enzyme, is reported.
25338677 Study of genetic heterogeneity in systemic lupus erythematosus, the top associations in European ancestry were protein kinase, cyclic GMP-dependent, type I (PRKG1) rs7897633 (P(Meta) = 2.75 x 10(-8)) and purine nucleoside phosphorylase (PNP) rs1049564 (P(Meta) = 1.24 x 10(-7)).
24792412 insufficient data to evaluated impact of genetic polymorphisms on disease susceptibility
24107682 Human small intestine is a key site for ribavirin phosphorolysis and that PNP is primarily involved in the metabolism.
22578971 Complete lack of PNP triggers accumulation of deoxyguanosine, thereby disrupting B-cell development, the consequence of which is more profound with time, as was found in the older sister.
22132981 Biochemical and genetic data on a cohort of seven patients from six families identified as PNPase deficient, is reported.
21448452 This study for the first time describes elevated levels of alpha synuclein in pancreatic adenocarcinoma as well as highlights the potential of evaluating NP protein expression.
21348499 investigation of catalytic mechanisms involved in catalysis by PNP: transition states in arsenolysis and phosphorolysis
More...

AA Sequence

MENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYGEIPNFPRSTVPGHAGRLVF      1 - 70
GFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPG     71 - 140
FSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQ    141 - 210
KLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMA    211 - 280
SIPLPDKAS                                                                 281 - 289
//

Text Mined References (68)

PMID Year Title
26985580 2016 Computer Simulations Reveal Substrate Specificity of Glycosidic Bond Cleavage in Native and Mutant Human Purine Nucleoside Phosphorylase.
26305965 2015 Isotope-specific and amino acid-specific heavy atom substitutions alter barrier crossing in human purine nucleoside phosphorylase.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25625196 2015 The ligand binding mechanism to purine nucleoside phosphorylase elucidated via molecular dynamics and machine learning.
25338677 Genetic analysis of the pathogenic molecular sub-phenotype interferon-alpha identifies multiple novel loci involved in systemic lupus erythematosus.
24792412 2014 AS3MT, GSTO, and PNP polymorphisms: impact on arsenic methylation and implications for disease susceptibility.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24107682 2014 Functional analysis of purine nucleoside phosphorylase as a key enzyme in ribavirin metabolism.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...