Property Summary

NCBI Gene PubMed Count 296
Grant Count 5
R01 Count 4
Funding $489,863.48
PubMed Score 191.57
PubTator Score 503.25

Knowledge Summary

Patent

No data available

Expression

Gene RIF (268)

PMID Text
26852661 Genetic basis of severe factor XIII deficiency in a large cohort of Indian patients has been uncovered.
26743168 Mutations in the activation peptide of full-length recombinant FXIII regulate activation rates by thrombin, and V34L influences in vivo thrombus formation by increased cross-linking of the clot.
26359437 These results indicate that FXIIIa activity can be modulated by fibrinolytic enzymes, and suggest that changes in fibrinolytic activity may influence cross-linking of blood proteins.
26324704 These findings expose a newly recognized, essential role for fibrin crosslinking during whole blood clot formation and consolidation and establish FXIIIa activity as a key determinant of thrombus composition and size.
26121426 Our meta-analysis suggests that there is no evidence for strong association between FXIII Val34Leu polymorphisms and intracerebral hemorrhage--{review}
26083359 Deletion of 11 or more N-terminal amino acids disrupts intersubunit interactions, which may prevent FXIII-A2 homodimer formation. AP-FXIII plays an important role in the stability of the FXIII-A2 dimer.
26035561 Genotype 163TT of FXIII-A gene as a new independent risk factor for the development of Venous Thromboembolism in young women living in the North-West region of Russia.
25947356 Different FXIII-A dynamics and levels could be utilised as early prognostic indicators during acute MI, revealing the individual potential to heal and suggesting tailored treatments to avoid heart failure or its extreme consequence.
25896761 This study presents the covalent structure of single-stranded fibrin oligomers cross-linked by FXIIIa.
25862345 FXIII Val34Leu polymorphism has a protective effect against recurrent spontaneous abortion.
More...

AA Sequence

MSETSRTAFGGRRAVPPNNSNAAEDDLPTVELQGVVPRGVNLQEFLNVTSVHLFKERWDTNKVDHHTDKY      1 - 70
ENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMRED     71 - 140
RSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETDTYILFNPWCEDDAVYLDNEKEREEYVLNDI    141 - 210
GVIFYGEVNDIKTRSWSYGQFEDGILDTCLYVMDRAQMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSW    211 - 280
DNIYAYGVPPSAWTGSVDILLEYRSSENPVRYGQCWVFAGVFNTFLRCLGIPARIVTNYFSAHDNDANLQ    281 - 350
MDIFLEEDGNVNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAIKH    351 - 420
GHVCFQFDAPFVFAEVNSDLIYITAKKDGTHVVENVDATHIGKLIVTKQIGGDGMMDITDTYKFQEGQEE    421 - 490
ERLALETALMYGAKKPLNTEGVMKSRSNVDMDFEVENAVLGKDFKLSITFRNNSHNRYTITAYLSANITF    491 - 560
YTGVPKAEFKKETFDVTLEPLSFKKEAVLIQAGEYMGQLLEQASLHFFVTARINETRDVLAKQKSTVLTI    561 - 630
PEIIIKVRGTQVVGSDMTVTVQFTNPLKETLRNVWVHLDGPGVTRPMKKMFREIRPNSTVQWEEVCRPWV    631 - 700
SGHRKLIASMSSDSLRHVYGELDVQIQRRPSM                                          701 - 732
//

Text Mined References (301)

PMID Year Title
27363989 2016 Coagulation Factor XIIIA Subunit Missense Mutations Affect Structure and Function at the Various Steps of Factor XIII Action.
26852661 2016 Genetic basis of severe factor XIII deficiency in a large cohort of Indian patients: Identification of fourteen novel mutations.
26743168 2016 Factor XIII A-Subunit V34L Variant Affects Thrombus Cross-Linking in a Murine Model of Thrombosis.
26359437 2015 Coagulation factor XIIIa is inactivated by plasmin.
26324704 2015 Factor XIIIa-dependent retention of red blood cells in clots is mediated by fibrin ?-chain crosslinking.
26247044 2015 Structural and functional influences of coagulation factor XIII subunit B heterozygous missense mutants.
26121426 2015 Blood coagulation factor XIII-A subunit Val34Leu polymorphisms and intracerebral hemorrhage risk: A meta-analysis of case-control studies.
26083359 2015 The activation peptide of coagulation factor XIII is vital for its expression and stability.
26035561 2015 [Factor XIII-A subunit Val34Leu polymorphism and risk of venous thromboembolism in young adults].
25947356 2015 Factor XIII-A dynamics in acute myocardial infarction: a novel prognostic biomarker?
More...