Property Summary

NCBI Gene PubMed Count 296
PubMed Score 191.57
PubTator Score 503.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
lung carcinoma 2844 2.67526842506443E-11
Duchenne muscular dystrophy 602 2.26756725896579E-10
primary Sjogren syndrome 789 4.18835585812881E-6
acute quadriplegic myopathy 1157 1.4214749486606E-5
interstitial cystitis 2299 8.94788736847613E-5
pituitary cancer 1972 1.42489935745665E-4
limb girdle muscular dystrophy 2B 74 2.02311763329196E-4
adrenocortical carcinoma 1427 4.57067442853665E-4
lung cancer 4473 4.7326255593206E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 5.53515336731396E-4
ovarian cancer 8492 5.93905181918394E-4
tuberculosis 1563 7.74936820711184E-4
Becker muscular dystrophy 187 0.00110196348061276
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00156907870804244
colon cancer 1475 0.00202690944024515
pancreatic cancer 2300 0.00290397324767166
pancreatic carcinoma 567 0.00290397324767166
posterior fossa group A ependymoma 1511 0.0030445183233586
invasive ductal carcinoma 2950 0.00492294415302214
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0116439101787525
Pick disease 1893 0.0124813275091778
ductal carcinoma in situ 1745 0.0152226907356022
diabetes mellitus 1663 0.0159224782821711
glioblastoma 5572 0.0196528540488975
Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 2.0
Disease Target Count
Factor XIII subunit A deficiency 1

Expression

Synonym

Gene

PANTHER Protein Class (2)

PDB

1EVU   1EX0   1F13   1FIE   1GGT   1GGU   1GGY   1QRK   4KTY  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

 CSPA Cell Line (1)

Gene RIF (268)

PMID Text
26852661 Genetic basis of severe factor XIII deficiency in a large cohort of Indian patients has been uncovered.
26743168 Mutations in the activation peptide of full-length recombinant FXIII regulate activation rates by thrombin, and V34L influences in vivo thrombus formation by increased cross-linking of the clot.
26359437 These results indicate that FXIIIa activity can be modulated by fibrinolytic enzymes, and suggest that changes in fibrinolytic activity may influence cross-linking of blood proteins.
26324704 These findings expose a newly recognized, essential role for fibrin crosslinking during whole blood clot formation and consolidation and establish FXIIIa activity as a key determinant of thrombus composition and size.
26121426 Our meta-analysis suggests that there is no evidence for strong association between FXIII Val34Leu polymorphisms and intracerebral hemorrhage--{review}
26083359 Deletion of 11 or more N-terminal amino acids disrupts intersubunit interactions, which may prevent FXIII-A2 homodimer formation. AP-FXIII plays an important role in the stability of the FXIII-A2 dimer.
26035561 Genotype 163TT of FXIII-A gene as a new independent risk factor for the development of Venous Thromboembolism in young women living in the North-West region of Russia.
25947356 Different FXIII-A dynamics and levels could be utilised as early prognostic indicators during acute MI, revealing the individual potential to heal and suggesting tailored treatments to avoid heart failure or its extreme consequence.
25896761 This study presents the covalent structure of single-stranded fibrin oligomers cross-linked by FXIIIa.
25862345 FXIII Val34Leu polymorphism has a protective effect against recurrent spontaneous abortion.
More...

AA Sequence

MSETSRTAFGGRRAVPPNNSNAAEDDLPTVELQGVVPRGVNLQEFLNVTSVHLFKERWDTNKVDHHTDKY      1 - 70
ENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMRED     71 - 140
RSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETDTYILFNPWCEDDAVYLDNEKEREEYVLNDI    141 - 210
GVIFYGEVNDIKTRSWSYGQFEDGILDTCLYVMDRAQMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSW    211 - 280
DNIYAYGVPPSAWTGSVDILLEYRSSENPVRYGQCWVFAGVFNTFLRCLGIPARIVTNYFSAHDNDANLQ    281 - 350
MDIFLEEDGNVNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAIKH    351 - 420
GHVCFQFDAPFVFAEVNSDLIYITAKKDGTHVVENVDATHIGKLIVTKQIGGDGMMDITDTYKFQEGQEE    421 - 490
ERLALETALMYGAKKPLNTEGVMKSRSNVDMDFEVENAVLGKDFKLSITFRNNSHNRYTITAYLSANITF    491 - 560
YTGVPKAEFKKETFDVTLEPLSFKKEAVLIQAGEYMGQLLEQASLHFFVTARINETRDVLAKQKSTVLTI    561 - 630
PEIIIKVRGTQVVGSDMTVTVQFTNPLKETLRNVWVHLDGPGVTRPMKKMFREIRPNSTVQWEEVCRPWV    631 - 700
SGHRKLIASMSSDSLRHVYGELDVQIQRRPSM                                          701 - 732
//

Text Mined References (301)

PMID Year Title
27363989 2016 Coagulation Factor XIIIA Subunit Missense Mutations Affect Structure and Function at the Various Steps of Factor XIII Action.
26852661 2016 Genetic basis of severe factor XIII deficiency in a large cohort of Indian patients: Identification of fourteen novel mutations.
26743168 2016 Factor XIII A-Subunit V34L Variant Affects Thrombus Cross-Linking in a Murine Model of Thrombosis.
26359437 2015 Coagulation factor XIIIa is inactivated by plasmin.
26324704 2015 Factor XIIIa-dependent retention of red blood cells in clots is mediated by fibrin ?-chain crosslinking.
26247044 2015 Structural and functional influences of coagulation factor XIII subunit B heterozygous missense mutants.
26121426 2015 Blood coagulation factor XIII-A subunit Val34Leu polymorphisms and intracerebral hemorrhage risk: A meta-analysis of case-control studies.
26083359 2015 The activation peptide of coagulation factor XIII is vital for its expression and stability.
26035561 2015 [Factor XIII-A subunit Val34Leu polymorphism and risk of venous thromboembolism in young adults].
25947356 2015 Factor XIII-A dynamics in acute myocardial infarction: a novel prognostic biomarker?
More...