Property Summary

Ligand Count 72
NCBI Gene PubMed Count 303
PubMed Score 200.75
PubTator Score 503.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 0.0353100345260238

Expression

  Differential Expression (25)

Disease log2 FC p
Alzheimer's disease 1.500 3.5e-02
acute quadriplegic myopathy 1.670 1.4e-05
adrenocortical carcinoma -2.763 4.6e-04
Becker muscular dystrophy 1.194 1.1e-03
colon cancer -3.500 2.0e-03
diabetes mellitus -1.300 1.6e-02
Duchenne muscular dystrophy 1.561 2.3e-10
ductal carcinoma in situ -1.100 1.5e-02
glioblastoma 3.000 2.0e-02
interstitial cystitis 1.100 3.1e-02
intraductal papillary-mucinous adenoma (... -3.100 5.5e-04
intraductal papillary-mucinous carcinoma... -3.100 1.6e-03
intraductal papillary-mucinous neoplasm ... -3.000 1.2e-02
invasive ductal carcinoma 1.443 4.3e-02
limb girdle muscular dystrophy 2A 1.199 6.3e-06
lung cancer -1.200 4.7e-04
lung carcinoma -1.200 2.7e-11
ovarian cancer -1.900 6.8e-08
pancreatic cancer 1.400 2.9e-03
pancreatic carcinoma 1.400 2.9e-03
Pick disease 1.600 1.2e-02
pituitary cancer -2.100 1.4e-04
posterior fossa group A ependymoma 1.400 3.0e-03
primary Sjogren syndrome 1.600 4.2e-06
tuberculosis 1.300 7.7e-04

 CSPA Cell Line (1)

Protein-protein Interaction (1)

Gene RIF (276)

AA Sequence

MSETSRTAFGGRRAVPPNNSNAAEDDLPTVELQGVVPRGVNLQEFLNVTSVHLFKERWDTNKVDHHTDKY      1 - 70
ENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMRED     71 - 140
RSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETDTYILFNPWCEDDAVYLDNEKEREEYVLNDI    141 - 210
GVIFYGEVNDIKTRSWSYGQFEDGILDTCLYVMDRAQMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSW    211 - 280
DNIYAYGVPPSAWTGSVDILLEYRSSENPVRYGQCWVFAGVFNTFLRCLGIPARIVTNYFSAHDNDANLQ    281 - 350
MDIFLEEDGNVNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAIKH    351 - 420
GHVCFQFDAPFVFAEVNSDLIYITAKKDGTHVVENVDATHIGKLIVTKQIGGDGMMDITDTYKFQEGQEE    421 - 490
ERLALETALMYGAKKPLNTEGVMKSRSNVDMDFEVENAVLGKDFKLSITFRNNSHNRYTITAYLSANITF    491 - 560
YTGVPKAEFKKETFDVTLEPLSFKKEAVLIQAGEYMGQLLEQASLHFFVTARINETRDVLAKQKSTVLTI    561 - 630
PEIIIKVRGTQVVGSDMTVTVQFTNPLKETLRNVWVHLDGPGVTRPMKKMFREIRPNSTVQWEEVCRPWV    631 - 700
SGHRKLIASMSSDSLRHVYGELDVQIQRRPSM                                          701 - 732
//

Text Mined References (308)

PMID Year Title