Property Summary

NCBI Gene PubMed Count 166
PubMed Score 683.90
PubTator Score 334.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Disease Target Count
Wilson disease 16
Aceruloplasminemia 16

Expression

  Differential Expression (28)

Disease log2 FC p
psoriasis -2.700 2.4e-05
adult high grade glioma 2.200 2.6e-03
astrocytoma 1.100 3.4e-04
Astrocytoma, Pilocytic 1.800 8.2e-03
Atopic dermatitis -2.000 3.2e-04
atypical teratoid / rhabdoid tumor 2.600 1.5e-02
Breast cancer 2.100 3.9e-02
colon cancer -3.300 1.6e-07
Endometriosis -1.610 1.1e-02
ependymoma 2.900 1.8e-05
glioblastoma 1.300 2.7e-02
interstitial cystitis 2.200 2.8e-02
interstitial lung disease 1.900 3.7e-02
lung adenocarcinoma 2.100 2.5e-06
lung cancer -3.500 8.8e-05
lung carcinoma -3.300 3.6e-10
medulloblastoma, large-cell 1.400 2.0e-03
mucosa-associated lymphoid tissue lympho... 1.637 8.1e-03
nasopharyngeal carcinoma -1.300 1.8e-02
non-small cell lung cancer 1.694 1.4e-04
osteosarcoma -5.703 2.7e-06
ovarian cancer 5.400 5.3e-10
pancreatic cancer 1.900 5.2e-03
pancreatic ductal adenocarcinoma liver m... -2.027 1.4e-03
Pick disease 2.700 5.6e-03
pituitary cancer -2.900 1.1e-05
primary Sjogren syndrome 1.200 1.2e-03
sarcoidosis 2.400 4.8e-02

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (112)

AA Sequence

MKILILGIFLFLCSTPAWAKEKHYYIGIIETTWDYASDHGEKKLISVDTEHSNIYLQNGPDRIGRLYKKA      1 - 70
LYLQYTDETFRTTIEKPVWLGFLGPIIKAETGDKVYVHLKNLASRPYTFHSHGITYYKEHEGAIYPDNTT     71 - 140
DFQRADDKVYPGEQYTYMLLATEEQSPGEGDGNCVTRIYHSHIDAPKDIASGLIGPLIICKKDSLDKEKE    141 - 210
KHIDREFVVMFSVVDENFSWYLEDNIKTYCSEPEKVDKDNEDFQESNRMYSVNGYTFGSLPGLSMCAEDR    211 - 280
VKWYLFGMGNEVDVHAAFFHGQALTNKNYRIDTINLFPATLFDAYMVAQNPGEWMLSCQNLNHLKAGLQA    281 - 350
FFQVQECNKSSSKDNIRGKHVRHYYIAAEEIIWNYAPSGIDIFTKENLTAPGSDSAVFFEQGTTRIGGSY    351 - 420
KKLVYREYTDASFTNRKERGPEEEHLGILGPVIWAEVGDTIRVTFHNKGAYPLSIEPIGVRFNKNNEGTY    421 - 490
YSPNYNPQSRSVPPSASHVAPTETFTYEWTVPKEVGPTNADPVCLAKMYYSAVDPTKDIFTGLIGPMKIC    491 - 560
KKGSLHANGRQKDVDKEFYLFPTVFDENESLLLEDNIRMFTTAPDQVDKEDEDFQESNKMHSMNGFMYGN    561 - 630
QPGLTMCKGDSVVWYLFSAGNEADVHGIYFSGNTYLWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECL    631 - 700
TTDHYTGGMKQKYTVNQCRRQSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDK    701 - 770
GEFYIGSKYKKVVYRQYTDSTFRVPVERKAEEEHLGILGPQLHADVGDKVKIIFKNMATRPYSIHAHGVQ    771 - 840
TESSTVTPTLPGETLTYVWKIPERSGAGTEDSACIPWAYYSTVDQVKDLYSGLIGPLIVCRRPYLKVFNP    841 - 910
RRKLEFALLFLVFDENESWYLDDNIKTYSDHPEKVNKDDEEFIESNKMHAINGRMFGNLQGLTMHVGDEV    911 - 980
NWYLMGMGNEIDLHTVHFHGHSFQYKHRGVYSSDVFDIFPGTYQTLEMFPRTPGIWLLHCHVTDHIHAGM    981 - 1050
ETTYTVLQNEDTKSG                                                          1051 - 1065
//

Text Mined References (169)

PMID Year Title