Property Summary

NCBI Gene PubMed Count 158
Grant Count 291
R01 Count 154
Funding $50,865,879.14
PubMed Score 747.03
PubTator Score 334.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (70)

Disease Z-score Confidence
Wilson disease 16 6.689 3.3
Aceruloplasminemia 17 5.519 2.8
Menkes disease 20 4.998 2.5
Hemochromatosis 55 3.961 2.0
Anemia 252 3.685 1.8
Vascular disease 281 3.325 1.7
Cancer 2,346 3.293 1.6
Neurodegenerative disease 383 3.275 1.6
Liver Cirrhosis 101 3.178 1.6
Ulcerative blepharitis 1 3.105 1.6
Hepatitis 61 3.061 1.5
Albuminuria 20
Arthritis, Experimental 39
Ataxia 15
Atopic dermatitis 944
Autistic Disorder 320
Brain Diseases 22
Breast cancer 3,094
Carcinoma 2,147 1.0
Ceruloplasmin deficiency 1
Colonic Neoplasms 126
Dementia 129
Diabetes Mellitus, Insulin-Dependent 76
Dyskinetic syndrome 6
Endometriosis 535
Familial apoceruloplasmin deficiency 2
HEMOSIDEROSIS, SYSTEMIC, DUE TO ACERULOP... 1 
Hepatitis, Chronic 22
Hepatolenticular Degeneration 24
IGA Glomerulonephritis 454
Iron Metabolism Disorders 5
Iron Overload 5
Ischemia 27
Liver Neoplasms, Experimental 48
Liver carcinoma 217
Melanoma 261
Menkes Kinky Hair Syndrome 2
Nerve Degeneration 73
Parkinson Disease 102
Pasteurellaceae Infections 3
Pick disease 1,893
Retinal Degeneration 49
Rheumatoid Arthritis 1,160
Schizophrenia 501
adult high grade glioma 2,148
astrocytoma 1,493
atypical teratoid / rhabdoid tumor 4,369
colon cancer 1,475
diabetes mellitus 1,663
glioblastoma 5,572
interstitial cystitis 2,299
interstitial lung disease 291
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
mucosa-associated lymphoid tissue lympho... 480 
nasopharyngeal carcinoma 1,056
non-small cell lung cancer 2,798
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pancreatic ductal adenocarcinoma liver m... 1,795 
pilocytic astrocytoma 3,086
pituitary cancer 1,972
posterior fossa group A ependymoma 1,511
pre-eclampsia 67
primary Sjogren syndrome 789
psoriasis 6,685
sarcoidosis 358

Expression

  Differential Expression (28)

Disease log2 FC p
psoriasis -2.700 0.000
interstitial lung disease 1.900 0.037
astrocytoma 1.100 0.000
glioblastoma 2.200 0.001
osteosarcoma -6.277 0.000
posterior fossa group A ependymoma 3.900 0.000
atypical teratoid / rhabdoid tumor 2.600 0.015
medulloblastoma, large-cell 1.400 0.002
Atopic dermatitis -2.100 0.000
pancreatic ductal adenocarcinoma liver m... -2.827 0.035
non-small cell lung cancer 2.284 0.000
colon cancer -3.300 0.000
lung cancer -3.500 0.000
sarcoidosis 2.400 0.048
pancreatic cancer 2.600 0.000
Breast cancer 2.100 0.039
interstitial cystitis 2.600 0.023
lung adenocarcinoma 2.959 0.000
adult high grade glioma 2.200 0.003
pilocytic astrocytoma 2.300 0.000
primary Sjogren syndrome 1.200 0.001
nasopharyngeal carcinoma -1.300 0.018
Endometriosis -1.857 0.029
lung carcinoma -3.300 0.000
Pick disease 2.700 0.006
mucosa-associated lymphoid tissue lympho... 1.637 0.008
ovarian cancer 5.400 0.000
pituitary cancer -2.900 0.000

Synonym

Accession P00450 Q14063 Q2PP18 Q9UKS4
Symbols CP-2

Gene

CP

PDB

1KCW   2J5W   4EJX   4ENZ  

 GWAS Trait (1)

Gene RIF (104)

PMID Text
26537957 pathological cerebrospinal fluid's environment of Parkinson's disease patients promoted the same modifications in the exogenously added ceruloplasmin
25843655 Cp-mediated neuroprotection occurs via the inhibition of seizure-associated oxidative damage.
25758665 results of this study suggest that common genetic variants of CP are associated with PD and further investigation is needed to explore their functions in Parkinson disease.
25661792 Homozygosity for c.1948G>A is described in a Dutch family with aceruloplasminemia.
25595436 sLe(x)/CP ratio tended to be higher for the pancreatic adenocarcinoma
25490030 PON-1 and ferroxidase activities in older patients with mild cognitive impairment, late onset Alzheimer's disease or vascular dementia
25463281 High ceruloplasmin levels are associated with preeclampsia.
25398823 A reduced serum FeOx activity, which can potentially lead to a rise in oxidative stress-induced biomolecular damage, seems to be a shared condition in inflammatory disorders of the central nervous system including MS.
25311416 brain microvascular endothelial cell -secreted cytokine activity increases the gene expression of neighboring C6 glioma CP, which reciprocally acts on basolateral BMVEC ferroportin to enhance brain iron import
25265377 Mercury metallation of the bacterial copper protein azurin is analogous to the one of human cerulopsmin and factor VIII in mercury poisoning.
More...

AA Sequence

MKILILGIFLFLCSTPAWAKEKHYYIGIIETTWDYASDHGEKKLISVDTEHSNIYLQNGPDRIGRLYKKA      1 - 70
LYLQYTDETFRTTIEKPVWLGFLGPIIKAETGDKVYVHLKNLASRPYTFHSHGITYYKEHEGAIYPDNTT     71 - 140
DFQRADDKVYPGEQYTYMLLATEEQSPGEGDGNCVTRIYHSHIDAPKDIASGLIGPLIICKKDSLDKEKE    141 - 210
KHIDREFVVMFSVVDENFSWYLEDNIKTYCSEPEKVDKDNEDFQESNRMYSVNGYTFGSLPGLSMCAEDR    211 - 280
VKWYLFGMGNEVDVHAAFFHGQALTNKNYRIDTINLFPATLFDAYMVAQNPGEWMLSCQNLNHLKAGLQA    281 - 350
FFQVQECNKSSSKDNIRGKHVRHYYIAAEEIIWNYAPSGIDIFTKENLTAPGSDSAVFFEQGTTRIGGSY    351 - 420
KKLVYREYTDASFTNRKERGPEEEHLGILGPVIWAEVGDTIRVTFHNKGAYPLSIEPIGVRFNKNNEGTY    421 - 490
YSPNYNPQSRSVPPSASHVAPTETFTYEWTVPKEVGPTNADPVCLAKMYYSAVDPTKDIFTGLIGPMKIC    491 - 560
KKGSLHANGRQKDVDKEFYLFPTVFDENESLLLEDNIRMFTTAPDQVDKEDEDFQESNKMHSMNGFMYGN    561 - 630
QPGLTMCKGDSVVWYLFSAGNEADVHGIYFSGNTYLWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECL    631 - 700
TTDHYTGGMKQKYTVNQCRRQSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDK    701 - 770
GEFYIGSKYKKVVYRQYTDSTFRVPVERKAEEEHLGILGPQLHADVGDKVKIIFKNMATRPYSIHAHGVQ    771 - 840
TESSTVTPTLPGETLTYVWKIPERSGAGTEDSACIPWAYYSTVDQVKDLYSGLIGPLIVCRRPYLKVFNP    841 - 910
RRKLEFALLFLVFDENESWYLDDNIKTYSDHPEKVNKDDEEFIESNKMHAINGRMFGNLQGLTMHVGDEV    911 - 980
NWYLMGMGNEIDLHTVHFHGHSFQYKHRGVYSSDVFDIFPGTYQTLEMFPRTPGIWLLHCHVTDHIHAGM    981 - 1050
ETTYTVLQNEDTKSG                                                          1051 - 1065
//

Text Mined References (161)

PMID Year Title
26537957 2015 Ceruloplasmin functional changes in Parkinson's disease-cerebrospinal fluid.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25843655 2015 Ceruloplasmin is an endogenous protectant against kainate neurotoxicity.
25758665 2015 Single-nucleotide polymorphisms and haplotypes of non-coding area in the CP gene are correlated with Parkinson's disease.
25661792 2015 Aceruloplasminemia presents as Type 1 diabetes in non-obese adults: a detailed case series.
25595436 2015 Identification of potential pancreatic cancer serum markers: Increased sialyl-Lewis X on ceruloplasmin.
25490030 2015 PON-1 and ferroxidase activities in older patients with mild cognitive impairment, late onset Alzheimer's disease or vascular dementia.
25463281 2015 Association between maternal micronutrient status, oxidative stress, and common genetic variants in antioxidant enzymes at 15 weeks? gestation in nulliparous women who subsequently develop preeclampsia.
25398823 Serum ferroxidase activity in patients with multiple sclerosis: a pilot study.
25311416 2014 Activation of C6 glioblastoma cell ceruloplasmin expression by neighboring human brain endothelia-derived interleukins in an in vitro blood-brain barrier model system.
More...