Property Summary

NCBI Gene PubMed Count 907
Grant Count 1,150
R01 Count 595
Funding $187,960,991.2
PubMed Score 1849.32
PubTator Score 5448.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (74)

Disease Z-score Confidence
Amyotrophic Lateral Sclerosis 431 8.399 4.0
Frontotemporal dementia 41 4.296 2.1
Down syndrome 548 4.236 2.1
Toxic encephalopathy 131 3.834 1.9
Alzheimer's disease 644 3.793 1.9
Lateral sclerosis 13 3.644 1.8
Muscular atrophy 67 3.62 1.8
Parkinson's disease 364 3.559 1.8
Spinal cord disease 22 3.514 1.8
Vascular disease 281 3.43 1.7
Huntington's disease 72 3.184 1.6
Kennedy's disease 13 3.176 1.6
Cancer 2,346 3.012 1.5
AMYOTROPHIC LATERAL SCLEROSIS 1 49
Aortic Diseases 6
Asphyxia neonatorum 9
Asthma 349
Atherosclerosis 275
Brain Ischemia 87
Cerebrovascular accident 44
Chronic progressive external ophthalmopl... 18 
Contact Dermatitis 80
Depressive disorder 48
Diabetes Mellitus, Experimental 106
Diabetes Mellitus, Non-Insulin-Dependent 157
Diabetic Retinopathy 53
Drug-Induced Liver Injury 118
Fatty Liver, Alcoholic 2
Fetal Growth Retardation 9
Gait Disorders, Neurologic 3
Glioma 65
Heart failure 80
Hemolysis (disorder) 6
Hepatitis, Chronic 22
Hypertensive disease 193
Hyperthyroidism 50
Hypotension 53
Hypothermia, natural 12
Inflammation 109
Iron deficiency anemia 6
Ischemia 27
Kidney Calculi 7
Liver diseases 66
MELAS syndrome 17
Marfan Syndrome 14
Meningomyelocele 4
Motor neuron disease 39
Multiple myeloma 1,327
Muscle Weakness 92
Myocardial Infarction 126
Necrosis 51
Neoplastic Cell Transformation 81
Nephrosis 18
Nerve Degeneration 73
Neurodegenerative disease 383 4.0
Obesity 616
Parkinson Disease 102
Protein Deficiency 3
Proteinuria 63
Reperfusion Injury 84
Retinal Degeneration 49
Schistosomiasis mansoni 3
Scrapie 15
Transient Ischemic Attack 10
Turner syndrome 31
Ureteral Calculi 4
Waldenstrons macroglobulinemia 765
Weight decreased 18
diabetes mellitus 1,663
hearing impairment 40
nervous system disorder 53
ovarian cancer 8,484
ovarian neoplasm 97
pancreatic ductal adenocarcinoma liver m... 1,795 

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.216 0.011
Multiple myeloma 2.221 0.000
pancreatic ductal adenocarcinoma liver m... -1.429 0.030
ovarian cancer 1.900 0.000

Synonym

Accession P00441 A6NHJ0 D3DSE4 Q16669 Q16711 Q16838 Q16839 Q16840 Q6NR85
Symbols ALS
SOD
ALS1
IPOA
hSod1
HEL-S-44
homodimer

Gene

PANTHER Protein Class (1)

PDB

1AZV   1BA9   1DSW   1FUN   1HL4   1HL5   1KMG   1L3N   1MFM   1N18   1N19   1OEZ   1OZT   1OZU   1P1V   1PTZ   1PU0   1RK7   1SOS   1SPD   1UXL   1UXM   2AF2   2C9S   2C9U   2C9V   2GBT   2GBU   2GBV   2LU5   2MP3   2NNX   2R27   2V0A   2VR6   2VR7   2VR8   2WKO   2WYT   2WYZ   2WZ0   2WZ5   2WZ6   2XJK   2XJL   2ZKW   2ZKX   2ZKY   3CQP   3CQQ   3ECU   3ECV   3ECW   3GQF   3GTV   3GZO   3GZP   3GZQ   3H2P   3H2Q   3HFF   3K91   3KH3   3KH4   3LTV   3QQD   3RE0   3T5W   4A7G   4A7Q   4A7S   4A7T   4A7U   4A7V   4B3E   4BCY   4BCZ   4BD4   4FF9   4MCM   4MCN   4NIN   4NIO   4NIP   4OH2   4SOD   4XCR   5DLI  

Gene RIF (846)

PMID Text
27264826 The methylation status OF extracellular superoxide dismutase gene is associated with the size of cerebral infarction, degree of cerebral arteriosclerosis and severity of neurological impairment.
27002158 Primary astrocytes isolated from mutant human superoxide dismutase 1-overexpressing mice as well as human post-mortem ALS spinal cord-derived astrocytes induce motor neuron death in co-culture. Increasing total and mitochondrial NAD(+) content in ALS astrocytes increases oxidative stress resistance and reverts their toxicity toward co-cultured motor neurons.
26984187 In transgenic mice expressing SOD1, lower POMC levels were observed in hypothalamus in an ALS model.
26947057 Data show that transformation of voltage dependent anion channel VDAC1 (Deltapor1) yeast with human Cu/Zn superoxide dismutase (SOD1) completely restores the cell growth deficit.
26810478 the results of the study suggest that an inherent low autophagy capacity might cause the selective vulnerability of the motor system to mutant SOD1s.
26761025 H5N1 infection in lung epithelial cells decreased SOD1 expression at mRNA and protein levels.
26756888 The results of this study provided the first in vivo evidence that highly specific inhibition of calpains in neurons by Calpastatin delays motor axon death and substantially extends lifespan in the hSOD1G93A ALS mouse
26719414 SOD1 mutants designed to promote trimerization increase cell death.
26710998 This study supports the view that rAAVrh10-miR-SOD1 merits further development for the treatment of SOD1-linked Amyotrophic lateral sclerosis in humans
26707483 we suggest that transduced Tat-SOD qualifies as an atheroprotective agent against oxidation-driven and inflammation-associated atherosclerosis
More...

AA Sequence

MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSR      1 - 70
KHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGN     71 - 140
AGSRLACGVIGIAQ                                                            141 - 154
//

Text Mined References (923)

PMID Year Title
27264826 2016 [Association of extracellular superoxide dismutase gene methylation with cerebral infarction].
27002158 2016 Enhancing NAD+ Salvage Pathway Reverts the Toxicity of Primary Astrocytes Expressing Amyotrophic Lateral Sclerosis-linked Mutant Superoxide Dismutase 1 (SOD1).
26984187 2016 Alterations in the hypothalamic melanocortin pathway in amyotrophic lateral sclerosis.
26947057 2016 Overexpression of human SOD1 in VDAC1-less yeast restores mitochondrial functionality modulating beta-barrel outer membrane protein genes.
26810478 2016 Low autophagy capacity implicated in motor system vulnerability to mutant superoxide dismutase.
26761025 2016 The Influenza Virus H5N1 Infection Can Induce ROS Production for Viral Replication and Host Cell Death in A549 Cells Modulated by Human Cu/Zn Superoxide Dismutase (SOD1) Overexpression.
26756888 2016 Calpastatin inhibits motor neuron death and increases survival of hSOD1(G93A) mice.
26719414 2016 Nonnative SOD1 trimer is toxic to motor neurons in a model of amyotrophic lateral sclerosis.
26710998 2016 Therapeutic rAAVrh10 Mediated SOD1 Silencing in Adult SOD1(G93A) Mice and Nonhuman Primates.
26707483 2016 Blockade of monocyte-endothelial trafficking by transduced Tat-superoxide dismutase protein.
More...