Property Summary

NCBI Gene PubMed Count 963
PubMed Score 1972.07
PubTator Score 5448.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Amyotrophic lateral sclerosis 451 8.441 4.0
Down syndrome 499 4.254 2.1
Muscular atrophy 71 3.654 1.8
AMYOTROPHIC LATERAL SCLEROSIS 1 49 0.0 0.0
Anemia, Iron-Deficiency 4 0.0 0.0
Aortic Diseases 6 0.0 0.0
Asphyxia neonatorum 11 0.0 0.0
Asthma 385 0.0 0.0
Atherosclerosis 291 0.0 0.0
Brain Ischemia 110 0.0 0.0
Cell Transformation, Neoplastic 97 0.0 0.0
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Deficiency Diseases 3 0.0 0.0
Depressive disorder 409 0.0 0.0
Dermatitis, Contact 71 0.0 0.0
Diabetes Mellitus, Experimental 108 0.0 0.0
Diabetes Mellitus, Type 2 142 0.0 0.0
Diabetic retinopathy 56 0.0 0.0
Disease Models, Animal 155 0.0 0.0
Fatty Liver 70 0.0 0.0
Fatty Liver, Alcoholic 3 0.0 0.0
Fetal Growth Retardation 189 0.0 0.0
Gait Disorders, Neurologic 3 0.0 0.0
Glioma 74 0.0 0.0
Hearing Loss 17 0.0 0.0
Heart failure 162 0.0 0.0
Hemolysis 6 0.0 0.0
Hepatitis, Chronic 23 0.0 0.0
Hypertension 396 0.0 0.0
Hyperthyroidism 53 0.0 0.0
Hypotension 82 0.0 0.0
Hypothermia 12 0.0 0.0
Inflammation 120 0.0 0.0
Ischemia 28 0.0 0.0
Ischemic Attack, Transient 10 0.0 0.0
Kidney Calculi 7 0.0 0.0
Liver diseases 87 0.0 0.0
MELAS syndrome 18 0.0 0.0
Marfan Syndrome 15 0.0 0.0
Meningomyelocele 6 0.0 0.0
Motor neuron disease 49 0.0 0.0
Myocardial Infarction 151 0.0 0.0
Necrosis 53 0.0 0.0
Nephrosis 21 0.0 0.0
Nerve Degeneration 121 0.0 0.0
Nervous System Diseases 53 0.0 0.0
Obesity 678 0.0 0.0
Ophthalmoplegia, Chronic Progressive External 5 0.0 0.0
Ovarian Neoplasms 102 0.0 0.0
Parkinson Disease 64 0.0 0.0
Protein Deficiency 3 0.0 0.0
Proteinuria 144 0.0 0.0
Pulmonary Fibrosis 106 0.0 0.0
Radiation Injuries, Experimental 11 0.0 0.0
Reperfusion Injury 86 0.0 0.0
Retinal Degeneration 106 0.0 0.0
Schistosomiasis mansoni 3 0.0 0.0
Scrapie 17 0.0 0.0
Spinal Cord Injuries 8 0.0 0.0
Stroke 33 0.0 0.0
Turner syndrome 28 0.0 0.0
Ureteral Calculi 4 0.0 0.0
Weight Loss 24 0.0 0.0
diabetes mellitus 1728 0.0 0.0
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 2.221 2.5e-04
ovarian cancer -1.400 1.2e-04
pancreatic ductal adenocarcinoma liver m... -1.429 3.0e-02
Waldenstrons macroglobulinemia 1.216 1.1e-02

Synonym

Accession P00441 A6NHJ0 D3DSE4 Q16669 Q16711 Q16838 Q16839 Q16840 Q6NR85
Symbols ALS
SOD
ALS1
IPOA
hSod1
HEL-S-44
homodimer

Gene

PANTHER Protein Class (1)

PDB

1AZV   1BA9   1DSW   1FUN   1HL4   1HL5   1KMG   1L3N   1MFM   1N18   1N19   1OEZ   1OZT   1OZU   1P1V   1PTZ   1PU0   1RK7   1SOS   1SPD   1UXL   1UXM   2AF2   2C9S   2C9U   2C9V   2GBT   2GBU   2GBV   2LU5   2MP3   2NAM   2NNX   2R27   2V0A   2VR6   2VR7   2VR8   2WKO   2WYT   2WYZ   2WZ0   2WZ5   2WZ6   2XJK   2XJL   2ZKW   2ZKX   2ZKY   3CQP   3CQQ   3ECU   3ECV   3ECW   3GQF   3GTV   3GZO   3GZP   3GZQ   3H2P   3H2Q   3HFF   3K91   3KH3   3KH4   3LTV   3QQD   3RE0   3T5W   4A7G   4A7Q   4A7S   4A7T   4A7U   4A7V   4B3E   4BCY   4BCZ   4BD4   4FF9   4MCM   4MCN   4NIN   4NIO   4NIP   4OH2   4SOD   4XCR   5DLI   5IIW   5J07   5J0C   5J0F   5J0G   5K02   5U9M  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Protein-protein Interaction (5)

Gene RIF (898)

AA Sequence

MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSR      1 - 70
KHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGN     71 - 140
AGSRLACGVIGIAQ                                                            141 - 154
//

Text Mined References (980)

PMID Year Title