Property Summary

Ligand Count 2
NCBI Gene PubMed Count 254
PubMed Score 662.56
PubTator Score 1445.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Phenylketonurias 2 0.0 0.0
Disease Target Count
Classical phenylketonuria 1
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Skin cancer 469 0.0 0.5

Expression

Gene RIF (162)

AA Sequence

MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPS      1 - 70
RLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGA     71 - 140
ELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIF    141 - 210
PLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPE    211 - 280
PDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSS    281 - 350
FGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQR    351 - 420
IEVLDNTQQLKILADSINSEIGILCSALQKIK                                          421 - 452
//

Text Mined References (261)

PMID Year Title