Property Summary

Ligand Count 1
NCBI Gene PubMed Count 1
PubMed Score 880.38
PubTator Score 7265.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Abdominal Pain 98
Abnormality of mitochondrial metabolism 9
Acidosis, Lactic 97
Anorexia 43
Anxiety 136
Anxiety disease 113
Attention deficit hyperactivity disorder 278
Blepharoptosis 231
Blindness, Cortical 24
Brain Ischemia 110
Cachexia 50
Cerebellar Ataxia 304
Cerebellar hypoplasia and atrophy 41
Cerebral Ischemia 37
Cerebral atrophy 178
Cerebral calcification 43
Clonus 18
Congenital Bilateral Cataracts 50
Congenital cataract 50
Congestive heart failure 113
Cortical visual impairment 24
Creatine phosphokinase serum increased 110
Cytochrome-c Oxidase Deficiency 17
Death in early adulthood 24
Decreased nerve conduction velocity 35
Dementia 175
Depressive disorder 409
Developmental regression 95
Diabetes Mellitus, Non-Insulin-Dependent 145
Disturbance of consciousness 12
Electromyogram abnormal 49
Elevated creatine kinase 110
Encephalopathies 43
Episodic vomiting 10
Fatigue 182
Forgetful 40
Frequent vomiting 10
Hallucinations 34
Hallucinations, Sensory 33
Hearing loss, progressive sensorineural 23
Heart failure 162
Hemianopsia 15
Hemiparesis 34
Highly variable severity 157
Hypertensive disease 292
Increase in blood pressure 119
Increased serum lactate 60
Intermittent migraine headaches 68
Lactic acidemia 95
Left Ventricular Hypertrophy 47
Loss of developmental milestones 95
Memory Loss 40
Memory impairment 40
Mental Depression 333
Mental deterioration in childhood 95
Migraine Disorders 76
Mitochondrial Myopathies 21
Muscle Weakness 170
Myopathy 185
Nausea and vomiting 97
Neurodevelopmental regression 95
Ophthalmoplegia 106
Pancreatitis 123
Psychomotor regression 95
Psychomotor regression beginning in infancy 95
Psychomotor regression in infants 95
Psychomotor regression, progressive 95
Ragged-red fibers 21
Respiratory Insufficiency 132
Respiratory function loss 121
Sensorineural Hearing Loss (disorder) 284
Sensorineural hearing loss, bilateral 18
Short stature 531
Stroke-like episodes 10
Tonic - clonic seizures 44
Variable expressivity 157
Wolff-Parkinson-White syndrome 19
abnormal growth 26
diabetes mellitus 1728
Disease Target Count Z-score Confidence
Malaria 160 4.06 2.0
Chagas disease 39 3.939 2.0
Pyosalpinx 5 3.392 1.7
Lactic acidosis 51 3.276 1.6

Expression

Gene RIF (35)

AA Sequence

MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQEMETVWTILPA      1 - 70
IILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNSYMLPPLFLEPGDLRLLDVDN     71 - 140
RVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLNQTTFTATRPGVYYGQCSEICGANHSFMPIV    141 - 210
LELIPLKIFEMGPVFTL                                                         211 - 227
//

Text Mined References (16)

PMID Year Title