Tchem | Cytochrome c oxidase subunit 1 |
Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme complex. CO I is the catalytic subunit of the enzyme. Electrons originating in cytochrome c are transferred via the copper A center of subunit 2 and heme A of subunit 1 to the bimetallic center formed by heme A3 and copper B.
Comments
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Leber hereditary optic neuropathy | 17 | 3.353 | 1.7 |
Nonsyndromic deafness | 121 | 0.0 | 4.0 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Echinococcosis | 28 | 6.294 | 3.1 |
Sparganosis | 4 | 5.089 | 2.5 |
Diphyllobothriasis | 6 | 5.051 | 2.5 |
Cysticercosis | 12 | 5.045 | 2.5 |
Myiasis | 8 | 4.925 | 2.5 |
Malaria | 140 | 4.836 | 2.4 |
Coenurosis | 4 | 4.809 | 2.4 |
Fascioliasis | 18 | 4.482 | 2.2 |
Mesocestoidiasis | 1 | 4.375 | 2.2 |
Paragonimiasis | 9 | 4.213 | 2.1 |
Lice infestation | 16 | 4.056 | 2.0 |
Mitochondrial myopathy | 24 | 3.946 | 2.0 |
Filariasis | 21 | 3.865 | 1.9 |
Fatal infantile encephalocardiomyopathy | 3 | 3.744 | 1.9 |
Chagas disease | 34 | 3.594 | 1.8 |
Opisthorchiasis | 14 | 3.303 | 1.7 |
Species | Source |
---|---|
Chimp | OMA EggNOG Inparanoid |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG |
Platypus | EggNOG Inparanoid |
Anole lizard | OMA EggNOG |
Xenopus | OMA Inparanoid |
C. elegans | OMA EggNOG Inparanoid |
Fruitfly | EggNOG Inparanoid |
S.cerevisiae | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
26225554 | patients with primary ovarian insufficiency exhibit an increased incidence of mitochondrial cytochrome c oxidase 1 gene mutations;MT-CO1 gene mutation may be causal in the disease |
25701779 | The m.9267G>C MT-COIII mutation was present with a nonsynonymous inherited mitochondrial homoplasmic variation MT-COI m.5913 G>A. |
25663696 | studies have provided mechanistic insights into crosstalk between assembly intermediates, import processes and the synthesis of COX subunits in mitochondria, thus linking conceptually separated functions. |
24956508 | A novel heteroplasmic mutation was identified in MTCO1, m.7402delC, causing frameshift and a premature termination codon in a mitochondrial encephalomyopathy patient with cytochrome c oxidase deficiency. |
23712756 | A novel m.6307A>G mutation in the mitochondrial COXI gene in asthenozoospermic infertile men. |
23509693 | mitochondrial DNA mutations in COI resulting in increased reactive oxygen and reactive nitrogen generation may be involved in prostate cancer biology |
23030649 | Possible association of a novel missense mutation A6375G in the mitochondrial cytochrome C oxidase I gene with asthenospermia in the Tunisian population |
22927926 | Abeta 1-42 bound to a peptide comprising the amino-terminal region of cytochrome c oxidase subunit 1 |
22419111 | Tat-induced mitochondrial membrane permeabilization is associated with inhibition of cytochrome c oxidase (COX) activity by Tat in disrupted mitochondria from human samples |
22252130 | Both full-length and truncated COX1 proteins physically interact with AFG3L2. |
More... |
MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTAHAFVMIFFMV 1 - 70 MPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLASAMVEAGAGTGWTVYPPLAGNYSHPG 71 - 140 ASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLL 141 - 210 TDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSI 211 - 280 GFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGSNMKWSAAVLWALGFIFLFTV 281 - 350 GGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIG 351 - 420 VNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMIWEAFASKRKVLMVEEPSM 421 - 490 NLEWLYGCPPPYHTFEEPVYMKS 491 - 513 //
PMID | Year | Title |
---|---|---|
26321642 | 2015 | MITRAC7 Acts as a COX1-Specific Chaperone and Reveals a Checkpoint during Cytochrome c Oxidase Assembly. |
26225554 | 2015 | Increased Incidence of Mitochondrial Cytochrome C Oxidase 1 Gene Mutations in Patients with Primary Ovarian Insufficiency. |
25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. |
19218458 | 2009 | A mitochondrial DNA mutation linked to colon cancer results in proton leaks in cytochrome c oxidase. |
16407113 | 2006 | Mitochondrial DNA mutations are established in human colonic stem cells, and mutated clones expand by crypt fission. |
16284789 | 2006 | Introducing a novel human mtDNA mutation into the Paracoccus denitrificans COX I gene explains functional deficits in a patient. |
14760490 | 2004 | Single nucleotide polymorphisms over the entire mtDNA genome that increase the power of forensic testing in Caucasians. |
12949126 | 2003 | Lineage-specific selection in human mtDNA: lack of polymorphisms in a segment of MTND5 gene in haplogroup J. |
12840039 | 2003 | Mitochondrial genome variation and evolutionary history of Australian and New Guinean aborigines. |
12140182 | 2002 | Metabolic consequences of a novel missense mutation of the mtDNA CO I gene. |
More... |