Property Summary

NCBI Gene PubMed Count 68
PubMed Score 830.61
PubTator Score 2185.12

Knowledge Summary


No data available



Accession P00390 C8KIL8 C8KIL9 C8KIM0 D3DSV3 Q7Z5C9 Q9NP63 GR
Symbols HEL-75



PANTHER Protein Class (2)


1ALG   1BWC   1DNC   1GRA   1GRB   1GRE   1GRF   1GRG   1GRH   1GRT   1GSN   1K4Q   1XAN   2AAQ   2GH5   2GRT   3DJG   3DJJ   3DK4   3DK8   3DK9   3GRS   3GRT   3SQP   4GR1   4GRT   5GRT  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (37)

26419038 The recurrence of benign tumors of mammary gland occurred predominantly in women-carriers of mutant alleles with polymorphism rs8190924 of gene GSR and AA rs3763511of gene DKK4.
26316444 Plasma glutathione reductase (GR) activity was correlated with erythrocyte GR activity and the erythrocyte reduced glutathione/glutathione disulfide ratio. A decrease in plasma GR activity was associated with an increase in mortality in septic shock.
25645953 Glutathione reductase reduces mitochondrial protein mitoNEET [2Fe-2S] clusters.
23770363 1,25 (OH) vitamin D significantly upregulated expression of GCLC and GR and lowered secretion of IL-8 and MCP-1 in high-glucose exposed U937 monocytes.
23637325 GSR was the most significant single SNP association with systemic lupus erythematosus in African Americans.
22944692 Positional proteomics analysis identifies the cleavage of human glutathione reductase, mitochondria (GSR) at amino acid residues 67-68 by the HIV-1 protease
22089180 The results demonstrate for the first time that glutathione reductase gene polymorphisms are significantly associated with bone mineral density.
21417634 Up-regulation of CAT and GR activity resulted in an increase in total antioxidant activity in A549 after exposure to B(a)P.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628807 novel glutathione reductase alternative splice variants

AA Sequence

FAVAVKMGATKADFDNTVAIHPTSSEELVTLR                                          491 - 522

Text Mined References (72)

PMID Year Title
26316444 2016 Plasma glutathione reductase activity and prognosis of septic shock.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25645953 2015 Reduction of mitochondrial protein mitoNEET [2Fe-2S] clusters by human glutathione reductase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23770363 2013 Vitamin D upregulates glutamate cysteine ligase and glutathione reductase, and GSH formation, and decreases ROS and MCP-1 and IL-8 secretion in high-glucose exposed U937 monocytes.
23637325 2013 Variable association of reactive intermediate genes with systemic lupus erythematosus in populations with different African ancestry.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.