Property Summary

Ligand Count 8
NCBI Gene PubMed Count 69
PubMed Score 863.75
PubTator Score 2185.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

Gene RIF (38)

AA Sequence

MALLPRALSAGAGPSWRRAARAFRGFLLLLPEPAALTRALSRAMACRQEPQPQGPPPAAGAVASYDYLVI      1 - 70
GGGSGGLASARRAAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHSEFMHDHADYGFPSCEGKFNW     71 - 140
RVIKEKRDAYVSRLNAIYQNNLTKSHIEIIRGHAAFTSDPKPTIEVSGKKYTAPHILIATGGMPSTPHES    141 - 210
QIPGASLGITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTE    211 - 280
ELENAGVEVLKFSQVKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVDCLLWAIGRVPNTKDLSLNKLGIQ    281 - 350
TDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFEYKEDSKLDYNNIPTVVFSHPP    351 - 420
IGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQG    421 - 490
FAVAVKMGATKADFDNTVAIHPTSSEELVTLR                                          491 - 522
//

Text Mined References (73)

PMID Year Title