Property Summary

NCBI Gene PubMed Count 71
Grant Count 76
R01 Count 42
Funding $17,277,516.58
PubMed Score 89.23
PubTator Score 136.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Rheumatoid Arthritis -1.800 0.026
astrocytoma 1.500 0.008
ependymoma 1.700 0.012
oligodendroglioma 1.700 0.001
osteosarcoma 1.320 0.048
atypical teratoid / rhabdoid tumor 1.400 0.001
glioblastoma 1.800 0.001
group 4 medulloblastoma 1.500 0.025
medulloblastoma, large-cell 1.700 0.000
primitive neuroectodermal tumor 1.200 0.001
breast carcinoma -1.100 0.000
fibroadenoma -1.100 0.012
pediatric high grade glioma 1.300 0.011
pilocytic astrocytoma 1.400 0.004
COPD -1.400 0.001
ductal carcinoma in situ -1.600 0.000
ovarian cancer -1.500 0.000

Synonym

Gene

PANTHER Protein Class (2)

PDB

1M91   1UMK  

Gene RIF (25)

PMID Text
26351264 CYB5R3 promotes colonization and metastasis formation and is a prognostic marker of disease-free and overall survival in estrogen receptor-negative breast cancer.
25521918 Genetic variation in CYB5R3 is associated with methemoglobin levels in preterm infants receiving nitric oxide therapy.
25225034 Variants in CYB5A and CYB5R3 should be considered in the evaluation of breast cancer risk in African American women.
24450884 The results unveil a potential mechanism of action by which CYB5R3 deficiency contributes to the pathophysiological underpinnings of neurological disorders in RHM patients.
24266649 NADH-CYB5R deficiency causes two forms of recessive congenital methemoglobinemia with cyanosis.
23866629 Population frequency and age of c.806C > T mutation in CYB5R3 gene as cause of recessive congenital methemoglobinemia in Yakutia.
23703616 Data indicate that mitochondrial amidoxime reducing components 1 and 2 together with the electron transport proteins NADH-cytochrome b5 reductase (CYB5R) and cytochrome b5 (CYB5) catalyze the reduction of N-hydroxylated compounds such as amidoximes.
23297489 Novel large deletion c.22-1320_633+1224del in the CYB5R3 gene from patients with hereditary methemoglobinemia
23113554 A comprehensive overview of the study of structure and function of human cytochrome b5 reductase.
21447608 We conclude that Cytochrome b(5)and cytochrome b(5) reductase catalyze the reduction of arylhydroxylamines in breast tissue.
More...

AA Sequence

MGAQLSTLGHMVLFPVWFLYSLLMKLFQRSTPAITLESPDIKYPLRLIDREIISHDTRRFRFALPSPQHI      1 - 70
LGLPVGQHIYLSARIDGNLVVRPYTPISSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTI     71 - 140
EFRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFAN    141 - 210
QTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMI    211 - 280
QYACLPNLDHVGHPTERCFVF                                                     281 - 301
//

Text Mined References (79)

PMID Year Title
26351264 2015 NADH-Cytochrome b5 Reductase 3 Promotes Colonization and Metastasis Formation and Is a Prognostic Marker of Disease-Free and Overall Survival in Estrogen Receptor-Negative Breast Cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25521918 2015 Genetic variation in CYB5R3 is associated with methemoglobin levels in preterm infants receiving nitric oxide therapy.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25225034 2014 Polymorphisms in the carcinogen detoxification genes CYB5A and CYB5R3 and breast cancer risk in African American women.
24450884 2014 Membrane-bound CYB5R3 is a common effector of nutritional and oxidative stress response through FOXO3a and Nrf2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24266649 2015 Clinical spectrum and molecular basis of recessive congenital methemoglobinemia in India.
23866629 2013 [Population frequency and age of c.806C > T mutation in CYB5R3 gene as cause of recessive congenital methemoglobinemia in Yakutia].
23703616 2013 The involvement of mitochondrial amidoxime reducing components 1 and 2 and mitochondrial cytochrome b5 in N-reductive metabolism in human cells.
More...