Property Summary

NCBI Gene PubMed Count 73
PubMed Score 94.56
PubTator Score 136.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma 1.100 4.3e-03
Astrocytoma, Pilocytic 1.400 4.4e-03
atypical teratoid / rhabdoid tumor 1.400 6.0e-04
breast carcinoma -1.100 1.7e-04
COPD -1.400 1.4e-03
ductal carcinoma in situ -1.600 3.1e-04
ependymoma 1.700 1.2e-02
fibroadenoma -1.100 1.2e-02
glioblastoma 1.800 6.9e-04
group 4 medulloblastoma 1.500 2.5e-02
medulloblastoma, large-cell 1.700 3.2e-05
oligodendroglioma 1.700 1.2e-03
osteosarcoma 1.320 4.8e-02
ovarian cancer -1.500 5.5e-08
pediatric high grade glioma 1.300 1.1e-02
primitive neuroectodermal tumor 1.200 1.0e-03
Rheumatoid arthritis -1.800 2.6e-02

Protein-protein Interaction (1)

Gene RIF (27)

AA Sequence

MGAQLSTLGHMVLFPVWFLYSLLMKLFQRSTPAITLESPDIKYPLRLIDREIISHDTRRFRFALPSPQHI      1 - 70
LGLPVGQHIYLSARIDGNLVVRPYTPISSDDDKGFVDLVIKVYFKDTHPKFPAGGKMSQYLESMQIGDTI     71 - 140
EFRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFAN    141 - 210
QTEKDILLRPELEELRNKHSARFKLWYTLDRAPEAWDYGQGFVNEEMIRDHLPPPEEEPLVLMCGPPPMI    211 - 280
QYACLPNLDHVGHPTERCFVF                                                     281 - 301
//

Text Mined References (81)

PMID Year Title