Property Summary

Ligand Count 512
NCBI Gene PubMed Count 147
PubMed Score 972.76
PubTator Score 1580.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Megaloblastic anemia 18

Expression

  Differential Expression (21)

Disease log2 FC p
osteosarcoma -2.326 6.7e-05
adrenocortical carcinoma 1.503 9.3e-05
adult high grade glioma 1.400 2.9e-03
atypical teratoid / rhabdoid tumor 1.500 6.5e-06
Breast cancer 3.000 4.2e-02
breast carcinoma 1.300 2.1e-02
colon cancer 1.100 2.1e-02
Endometriosis 1.149 2.4e-02
ependymoma 1.400 1.9e-10
glioblastoma 1.300 7.8e-06
group 3 medulloblastoma 2.100 2.4e-06
intraductal papillary-mucinous adenoma (... 1.100 4.0e-02
intraductal papillary-mucinous carcinoma... 1.800 1.1e-04
intraductal papillary-mucinous neoplasm ... 1.700 2.7e-03
lung cancer 1.400 1.4e-02
malignant mesothelioma 1.500 7.2e-07
medulloblastoma, large-cell 2.000 3.5e-06
non-small cell lung cancer 1.008 3.0e-13
primitive neuroectodermal tumor 1.800 2.0e-04
psoriasis 1.500 8.9e-12
tuberculosis 1.200 5.6e-07

 GO Component (2)

Gene RIF (130)

AA Sequence

MVGSLNCIVAVSQNMGIGKNGDLPWPPLRNEFRYFQRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPLKG      1 - 70
RINLVLSRELKEPPQGAHFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIM     71 - 140
QDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND                           141 - 187
//

Text Mined References (160)

PMID Year Title