Property Summary

NCBI Gene PubMed Count 141
PubMed Score 960.45
PubTator Score 1580.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 3.75305469196805E-9
glioblastoma 5572 1.10690307427618E-8
atypical teratoid/rhabdoid tumor 1095 1.26738202138431E-8
tuberculosis 1563 6.93047874514986E-8
malignant mesothelioma 3163 2.02573045471377E-7
medulloblastoma, large-cell 6234 5.70820747267956E-7
adrenocortical carcinoma 1427 9.59908668754975E-6
pediatric high grade glioma 2712 2.43851325051976E-5
group 3 medulloblastoma 2254 4.10017571437663E-5
primitive neuroectodermal tumor 3031 2.01392734433641E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 6.17605850712883E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0102073051702964
lung cancer 4473 0.0139763478180573
breast carcinoma 1614 0.0209307837307334
colon cancer 1475 0.0212405713523464
Endometriosis 535 0.039737840866267
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0401203761301061
Breast cancer 3099 0.0420288587377167

Expression

Synonym

Accession P00374 B4DDD2 Q14130 Q6IRW8
Symbols DYR
DHFRP1

Gene

PANTHER Protein Class (2)

PDB

1BOZ   1DHF   1DLR   1DLS   1DRF   1HFP   1HFQ   1HFR   1KMS   1KMV   1MVS   1MVT   1OHJ   1OHK   1PD8   1PD9   1PDB   1S3U   1S3V   1S3W   1U71   1U72   1YHO   2C2S   2C2T   2DHF   2W3A   2W3B   2W3M   3EIG   3F8Y   3F8Z   3F91   3FS6   3GHC   3GHV   3GHW   3GI2   3GYF   3L3R   3N0H   3NTZ   3NU0   3NXO   3NXR   3NXT   3NXV   3NXX   3NXY   3NZD   3OAF   3S3V   3S7A   4DDR   4G95   4KAK   4KBN   4KD7   4KEB   4KFJ   4M6J   4M6K   4M6L   4QHV   4QJC  

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid

 GO Component (2)

 MGI Term (1)

Gene RIF (125)

PMID Text
26875486 In conclusion, the finding suggests that folate nutrition and 19bp del-DHFR [Dihydrofolate reductase] variation may interact to modify adenomatous polyp [colorectal cancer] risk.
26813442 Data suggest that DHFR exhibits intrinsic activity kinetics that are temperature-independent; additional mass (i.e., incorporation of H, C, and N isotopes) has no effect on intrinsic activity kinetics or protein conformation/stability of DHFR.
26676887 the highest expression of GGH and EGFR was noted in the left-sided colon; the highest expression of DHFR, FPGS, TOP1 and ERCC1 was noted in the rectosigmoid, whereas TYMP expression was approximately equivalent in the right-sided colon and rectum
26506238 Overexpression of miR-192 inhibited cellular proliferation by binding DHFR. miR-192 decreased cellular anchoring via the repression of ITGAV, ITGB1, ITGB3, and CD47
26381869 S-nitrosylation of DHFR at cysteine 7 by eNOS-derived NO is crucial for DHFR stability.
26354538 the association between cognitive outcomes with the 19-bp deletion DHFR polymorphism, folate status, and their interaction with high or normal plasma folate
26349210 The human dihydrofolate reductase is relatively less stable than its E.coli counterpart.
26269242 genetic association studies in cohort of healthy young adults in Ireland: Data suggest that a 19 bp deletion/insertion polymorphism within intron 1 of DHFR (rs70991108) is not associated with folate nutritional status in the population studied.
26242737 Dihydrofolate Reductase and Thymidylate Synthase Transgenes Resistant to Methotrexate Interact to Permit Novel Transgene Regulation.
26221921 results for the first time suggested the DHFR 19-bp D/D genotype may confer a reduced risk of NS-CL/P and might act as a protective factor against NS-CL/P in the Iranian subjects.
More...

AA Sequence

MVGSLNCIVAVSQNMGIGKNGDLPWPPLRNEFRYFQRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPLKG      1 - 70
RINLVLSRELKEPPQGAHFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIM     71 - 140
QDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND                           141 - 187
//

Text Mined References (154)

PMID Year Title
26875486 2015 Gene-Nutrient Interaction between Folate and Dihydrofolate Reductase in Risk for Adenomatous Polyp Occurrence: A Preliminary Report.
26813442 2016 The Effect of Protein Mass Modulation on Human Dihydrofolate Reductase.
26676887 2016 Association between mRNA expression of chemotherapy-related genes and clinicopathological features in colorectal cancer: A large-scale population analysis.
26506238 2015 miR-192 suppresses leptomeningeal dissemination of medulloblastoma by modulating cell proliferation and anchoring through the regulation of DHFR, integrins, and CD47.
26381869 2015 Endothelial Nitric Oxide Synthase-Derived Nitric Oxide Prevents Dihydrofolate Reductase Degradation via Promoting S-Nitrosylation.
26354538 2015 Dihydrofolate reductase 19-bp deletion polymorphism modifies the association of folate status with memory in a cross-sectional multi-ethnic study of adults.
26349210 [Comparison of Physico-chemical Aspects between E. coli and Human Dihydrofolate Reductase: an Equilibrium Unfolding Study].
26269242 2015 The Dihydrofolate Reductase 19 bp Polymorphism Is Not Associated with Biomarkers of Folate Status in Healthy Young Adults, Irrespective of Folic Acid Intake.
26242737 2015 Dihydrofolate Reductase and Thymidylate Synthase Transgenes Resistant to Methotrexate Interact to Permit Novel Transgene Regulation.
26221921 The 19-bp deletion polymorphism of dihydrofolate reductase (DHFR) and nonsyndromic cleft lip with or without cleft palate: evidence for a protective role.
More...