Property Summary

NCBI Gene PubMed Count 141
Grant Count 690
R01 Count 455
Funding $120,970,262.87
PubMed Score 960.45
PubTator Score 1580.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (54)

Disease Z-score Confidence
Malaria 140 4.965 2.5
Cancer 2,346 4.442 2.2
Pneumocystosis 18 3.903 2.0
Cockayne syndrome 54 3.17 1.6
Cryptosporidiosis 12 3.155 1.6
Acute lymphoid leukemia 25
Adverse reaction to drug 54
Anemia, Megaloblastic 4
Autistic Disorder 320
Breast cancer 3,094
Burkitt's lymphoma 15
Carcinoma of female breast 20
Colorectal Neoplasms 217
Drug-Induced Liver Injury 118
Endometriosis 535
Female infertility 28
Folic Acid Deficiency 1
Gestational trophoblastic neoplasia 14
Inborn Errors of Metabolism 16
Juvenile rheumatoid arthritis 104
Malignant mesothelioma of pleura 7
Malignant tumor of head and/or neck 15
Malignant tumor of lung 5
Mammary Neoplasms 410
Megaloblastic Anemia due to Dihydrofolat... 1 
Meningeal Leukemia 7
Mycosis fungoides 28
Neoplasm Metastasis 138
Non-Hodgkin's lymphoma 22
Osteosarcoma of bone 6
Pancytopenia 9
Peripheral T-cell lymphoma 24
Rheumatoid Arthritis 1,160
Spontaneous abortion 108
adrenocortical carcinoma 1,427
atypical teratoid/rhabdoid tumor 1,095
breast carcinoma 1,614
colon cancer 1,475
glioblastoma 5,572
group 3 medulloblastoma 2,254
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
lung cancer 4,466
malignant mesothelioma 3,162
medulloblastoma, large-cell 6,234
nervous system disorder 53
non-small cell lung cancer 2,798
osteosarcoma 7,933
pediatric high grade glioma 2,712
posterior fossa group A ependymoma 1,511
primitive neuroectodermal tumor 3,031
psoriasis 6,685
tuberculosis 1,557

Expression

Synonym

Accession P00374 B4DDD2 Q14130 Q6IRW8
Symbols DYR
DHFRP1

Gene

PANTHER Protein Class (2)

PDB

1BOZ   1DHF   1DLR   1DLS   1DRF   1HFP   1HFQ   1HFR   1KMS   1KMV   1MVS   1MVT   1OHJ   1OHK   1PD8   1PD9   1PDB   1S3U   1S3V   1S3W   1U71   1U72   1YHO   2C2S   2C2T   2DHF   2W3A   2W3B   2W3M   3EIG   3F8Y   3F8Z   3F91   3FS6   3GHC   3GHV   3GHW   3GI2   3GYF   3L3R   3N0H   3NTZ   3NU0   3NXO   3NXR   3NXT   3NXV   3NXX   3NXY   3NZD   3OAF   3S3V   3S7A   4DDR   4G95   4KAK   4KBN   4KD7   4KEB   4KFJ   4M6J   4M6K   4M6L   4QHV   4QJC  

 GO Component (2)

 MGI Term (1)

Gene RIF (125)

PMID Text
26875486 In conclusion, the finding suggests that folate nutrition and 19bp del-DHFR [Dihydrofolate reductase] variation may interact to modify adenomatous polyp [colorectal cancer] risk.
26813442 Data suggest that DHFR exhibits intrinsic activity kinetics that are temperature-independent; additional mass (i.e., incorporation of H, C, and N isotopes) has no effect on intrinsic activity kinetics or protein conformation/stability of DHFR.
26676887 the highest expression of GGH and EGFR was noted in the left-sided colon; the highest expression of DHFR, FPGS, TOP1 and ERCC1 was noted in the rectosigmoid, whereas TYMP expression was approximately equivalent in the right-sided colon and rectum
26506238 Overexpression of miR-192 inhibited cellular proliferation by binding DHFR. miR-192 decreased cellular anchoring via the repression of ITGAV, ITGB1, ITGB3, and CD47
26381869 S-nitrosylation of DHFR at cysteine 7 by eNOS-derived NO is crucial for DHFR stability.
26354538 the association between cognitive outcomes with the 19-bp deletion DHFR polymorphism, folate status, and their interaction with high or normal plasma folate
26349210 The human dihydrofolate reductase is relatively less stable than its E.coli counterpart.
26269242 genetic association studies in cohort of healthy young adults in Ireland: Data suggest that a 19 bp deletion/insertion polymorphism within intron 1 of DHFR (rs70991108) is not associated with folate nutritional status in the population studied.
26242737 Dihydrofolate Reductase and Thymidylate Synthase Transgenes Resistant to Methotrexate Interact to Permit Novel Transgene Regulation.
26221921 results for the first time suggested the DHFR 19-bp D/D genotype may confer a reduced risk of NS-CL/P and might act as a protective factor against NS-CL/P in the Iranian subjects.
More...

AA Sequence

MVGSLNCIVAVSQNMGIGKNGDLPWPPLRNEFRYFQRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPLKG      1 - 70
RINLVLSRELKEPPQGAHFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIM     71 - 140
QDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND                           141 - 187
//

Text Mined References (154)

PMID Year Title
26875486 2015 Gene-Nutrient Interaction between Folate and Dihydrofolate Reductase in Risk for Adenomatous Polyp Occurrence: A Preliminary Report.
26813442 2016 The Effect of Protein Mass Modulation on Human Dihydrofolate Reductase.
26676887 2016 Association between mRNA expression of chemotherapy-related genes and clinicopathological features in colorectal cancer: A large-scale population analysis.
26506238 2015 miR-192 suppresses leptomeningeal dissemination of medulloblastoma by modulating cell proliferation and anchoring through the regulation of DHFR, integrins, and CD47.
26381869 2015 Endothelial Nitric Oxide Synthase-Derived Nitric Oxide Prevents Dihydrofolate Reductase Degradation via Promoting S-Nitrosylation.
26354538 2015 Dihydrofolate reductase 19-bp deletion polymorphism modifies the association of folate status with memory in a cross-sectional multi-ethnic study of adults.
26349210 [Comparison of Physico-chemical Aspects between E. coli and Human Dihydrofolate Reductase: an Equilibrium Unfolding Study].
26269242 2015 The Dihydrofolate Reductase 19 bp Polymorphism Is Not Associated with Biomarkers of Folate Status in Healthy Young Adults, Irrespective of Folic Acid Intake.
26242737 2015 Dihydrofolate Reductase and Thymidylate Synthase Transgenes Resistant to Methotrexate Interact to Permit Novel Transgene Regulation.
26221921 The 19-bp deletion polymorphism of dihydrofolate reductase (DHFR) and nonsyndromic cleft lip with or without cleft palate: evidence for a protective role.
More...