Property Summary

NCBI Gene PubMed Count 114
PubMed Score 245.31
PubTator Score 413.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.49886295384228E-6
group 4 medulloblastoma 1875 4.08928130876618E-6
primitive neuroectodermal tumor 3031 6.17594382124288E-5
adult high grade glioma 2148 2.21955833480354E-4
osteosarcoma 7933 4.05107531339088E-4
ovarian cancer 8492 4.52963830470959E-4
medulloblastoma, large-cell 6234 4.57633341709462E-4
glioblastoma 5572 5.06842344873551E-4
Multiple myeloma 1328 5.28565039118434E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 7.49284016168497E-4
psoriasis 6685 0.00154352845350988
Down syndrome 548 0.00399881679776072
subependymal giant cell astrocytoma 2287 0.047338281070306
Disease Target Count Z-score Confidence
Hyperinsulinemic hypoglycemia 17 4.58 2.3
Disease Target Count Z-score Confidence
Hypoglycemia 81 4.038 2.0

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 1.041 0.001
psoriasis -1.200 0.002
osteosarcoma 1.349 0.000
group 4 medulloblastoma -2.000 0.000
glioblastoma -2.100 0.001
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma, large-cell -1.500 0.000
primitive neuroectodermal tumor -1.300 0.000
pancreatic ductal adenocarcinoma liver m... -3.058 0.001
adult high grade glioma -1.500 0.000
subependymal giant cell astrocytoma -1.162 0.047
ovarian cancer 1.700 0.000
Down syndrome 1.300 0.004

Synonym

Accession P00367 B3KV55 B4DGN5 Q5TBU3 GDH 1
Symbols GDH
GDH1
GLUD

Gene

PANTHER Protein Class (2)

PDB

1L1F   1NR1  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Anole lizard OMA EggNOG
Zebrafish OMA EggNOG

Gene RIF (50)

PMID Text
26241911 Study of the expression of the GDH1/2 in human steroidogenic organs revealed that, while GDH2 was expressed specifically in steroid-synthesizing cells, GDH1 was expressed both in the cells that produce steroids and in those that lack endocrine function.
25947346 GDH plays a critical role in colorectal cancer progression
25781533 Mutation in the GLUD1 gene is associated with hyperinsulinism/hyperammonemia.
25670081 argeting GDH1 by shRNA or a small molecule inhibitor R162 resulted in imbalanced redox homeostasis, leading to attenuated cancer cell proliferation and tumor growth.
25620628 side-chain interactions between 409 and 443 positions in the 'antenna' region of GDH are crucial for basal catalytic activity, allosteric regulation, and relative resistance to thermal inactivation
24771001 SIRT3 and glutamate dehydrogenase are altered in follicular cells of women with reduced ovarian reserve or advanced maternal age
24295216 The GDH1 is a key metabolic enzyme with emerging roles in insulin regulation. MitoNEET forms a covalent complex with GDH1 through disulfide bond formation and acts as an activator.
23636801 stromal expression of the glutamine-metabolism-related proteins GLS1, GDH, ASCT2 increases with worsening histological phyllodes tumor grade.
23575388 The data suggest a dual mechanism by which glutamate dehydrogenase activity modulates autophagy, i.e., by activating MTORC1 and by limiting the formation of reactive oxygen species.
23507704 HER2- type breast cancer had the highest expression of stromal GLS1, tumoral GDH, stromal GDH, and tumoral ASCT, while TNBC had the lowest tumoral GDH expression.
More...

AA Sequence

MYRYLGEALLLSRAGPAALGSASADSAALLGWARGQPAAAPQPGLALAARRHYSEAVADREDDPNFFKMV      1 - 70
EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSFPIRRDDGSWEVIEGYRAQHS     71 - 140
QHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTDNELEKITRRFTMELA    141 - 210
KKGFIGPGIDVPAPDMSTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGI    211 - 280
ENFINEASYMSILGMTPGFGDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELED    281 - 350
FKLQHGSILGFPKAKPYEGSILEADCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLER    351 - 420
NIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGGTIPIVPT    421 - 490
AEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYVNAIEKVFKVYNEAGVTFT      491 - 558
//

Text Mined References (118)

PMID Year Title
26759084 2016 Early Presentation of Hyperinsulinism/Hyperammonemia Syndrome in Three Serbian Patients.
26758964 2016 Clinical and Genetic Characteristics, Management and Long-Term Follow-Up of Turkish Patients with Congenital Hyperinsulinism.
26740944 2015 Uncovering the molecular pathogenesis of congenital hyperinsulinism by panel gene sequencing in 32 Chinese patients.
26656609 2016 A novel mutation in the glutamate dehydrogenase (GLUD1) of a patient with congenital hyperinsulinism-hyperammonemia (HI/HA).
26511081 2016 Falsely Elevated Glucose Concentrations in Peritoneal Dialysis Patients Using Icodextrin.
26431509 2015 High Incidence of Heterozygous ABCC8 and HNF1A Mutations in Czech Patients With Congenital Hyperinsulinism.
26422656 2016 Protein profiles distinguish stable and progressive chronic lymphocytic leukemia.
26316429 2015 The Diagnosis and Management of Hyperinsulinaemic Hypoglycaemia.
26268944 2015 Genotype and phenotype correlations in Iranian patients with hyperinsulinaemic hypoglycaemia.
26241911 2015 Expression of human GLUD1 and GLUD2 glutamate dehydrogenases in steroid producing tissues.
More...