Property Summary

NCBI Gene PubMed Count 121
PubMed Score 257.69
PubTator Score 413.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.500 2.2e-04
atypical teratoid / rhabdoid tumor -1.600 1.1e-05
Down syndrome 1.300 4.0e-03
glioblastoma -2.100 5.1e-04
group 3 medulloblastoma -1.200 8.6e-03
medulloblastoma, large-cell -1.500 4.6e-04
Multiple myeloma 1.041 5.3e-04
osteosarcoma 1.349 4.1e-04
ovarian cancer 1.300 2.2e-03
pancreatic ductal adenocarcinoma liver m... -3.058 7.5e-04
primitive neuroectodermal tumor -1.200 7.9e-04
psoriasis -1.200 1.5e-03
subependymal giant cell astrocytoma -1.162 4.7e-02

 GWAS Trait (1)

Gene RIF (59)

AA Sequence

MYRYLGEALLLSRAGPAALGSASADSAALLGWARGQPAAAPQPGLALAARRHYSEAVADREDDPNFFKMV      1 - 70
EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSFPIRRDDGSWEVIEGYRAQHS     71 - 140
QHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTDNELEKITRRFTMELA    141 - 210
KKGFIGPGIDVPAPDMSTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGI    211 - 280
ENFINEASYMSILGMTPGFGDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELED    281 - 350
FKLQHGSILGFPKAKPYEGSILEADCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLER    351 - 420
NIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGGTIPIVPT    421 - 490
AEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYVNAIEKVFKVYNEAGVTFT      491 - 558
//

Text Mined References (125)

PMID Year Title