Property Summary

Ligand Count 19
NCBI Gene PubMed Count 266
PubMed Score 648.30
PubTator Score 484.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (30)

Disease log2 FC p
acute myeloid leukemia -3.000 3.3e-03
adrenocortical carcinoma -3.081 3.8e-03
adult high grade glioma -2.900 7.3e-05
Astrocytoma, Pilocytic -3.900 4.4e-11
Atopic dermatitis -1.800 6.4e-05
atypical teratoid / rhabdoid tumor -3.100 6.4e-03
Breast cancer -2.600 1.0e-02
breast carcinoma -1.800 5.9e-05
chronic rhinosinusitis -1.465 3.3e-02
colon cancer -1.400 1.5e-02
ductal carcinoma in situ -1.700 1.1e-04
ependymoma -3.100 5.6e-06
esophageal adenocarcinoma 1.300 3.3e-02
fibroadenoma -2.300 2.3e-04
glioblastoma -3.100 1.3e-08
group 3 medulloblastoma -4.100 3.0e-08
hereditary spastic paraplegia -1.349 5.7e-03
interstitial cystitis -1.200 1.5e-03
invasive ductal carcinoma -1.256 2.7e-02
lung adenocarcinoma -1.100 1.1e-04
lung cancer -1.700 2.5e-04
lung carcinoma -2.100 5.7e-07
medulloblastoma, large-cell -4.500 1.4e-07
nasopharyngeal carcinoma -2.000 7.0e-03
ovarian cancer -5.200 1.7e-19
pituitary cancer -2.500 4.2e-03
primitive neuroectodermal tumor -3.200 4.9e-03
psoriasis -1.100 2.0e-04
tuberculosis 3.800 1.9e-07
urothelial carcinoma -2.400 3.7e-02

PDB (10)

Gene RIF (243)

AA Sequence

MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQA      1 - 70
FQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKI     71 - 140
QGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIK    141 - 210
EAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLA    211 - 280
DADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQ    281 - 350
YDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR    351 - 420
ANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVK    421 - 490
TVTVKISQKNS                                                               491 - 501
//

Text Mined References (273)

PMID Year Title