Property Summary

NCBI Gene PubMed Count 226
Grant Count 161
R01 Count 99
Funding $12,195,227.86
PubMed Score 583.43
PubTator Score 484.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
urothelial carcinoma -2.400 0.037
esophageal adenocarcinoma 1.300 0.033
psoriasis -1.300 0.017
posterior fossa group A ependymoma -3.700 0.000
glioblastoma -3.800 0.000
group 4 medulloblastoma -4.400 0.000
atypical teratoid / rhabdoid tumor -3.100 0.006
medulloblastoma, large-cell -4.500 0.000
primitive neuroectodermal tumor -3.200 0.005
hereditary spastic paraplegia -1.349 0.006
Atopic dermatitis -1.800 0.000
adrenocortical carcinoma -3.081 0.004
tuberculosis 3.800 0.000
colon cancer -1.400 0.015
lung cancer -1.700 0.000
breast carcinoma -2.000 0.000
fibroadenoma -2.300 0.000
interstitial cystitis -1.200 0.001
lung adenocarcinoma -2.200 0.000
pediatric high grade glioma -3.700 0.000
pilocytic astrocytoma -3.900 0.000
Breast cancer -2.600 0.010
invasive ductal carcinoma -1.800 0.008
nasopharyngeal carcinoma -2.000 0.007
lung carcinoma -2.100 0.000
ductal carcinoma in situ -1.700 0.000
acute myeloid leukemia -3.000 0.003
ovarian cancer -5.200 0.000
pituitary cancer -2.500 0.004
chronic rhinosinusitis -1.465 0.033

Synonym

Accession P00352 O00768 Q5SYR1 RALDH 1
Symbols ALDC
ALDH1
HEL-9
HEL12
PUMB1
ALDH11
RALDH1
ALDH-E1
HEL-S-53e

Gene

PANTHER Protein Class (2)

PDB

4WB9   4WJ9   4WP7   4WPN   4X4L   5AC2  

Gene RIF (204)

PMID Text
27239845 Even at early stages of malignant transformation, a significant decrease in ADH1B, ADH3, RDHL, and RALDH1 mRNA levels was observed in 82, 79, 73, and 64% of tumor specimens, respectively
26896768 ALDH1A1 stabilizes the Gli2 protein in an enzyme-independent manner hepatocellular cancer.ALDH1A1 is a positive regulator of the Hedgehog signaling pathway.
26682730 Data show that high ALDH1 expression indicates a poor prognosis in colorectal cancer patients correlating with the T stage, N stage, and tumor differentiation, but not with age. [review]
26625750 Detecting the expression of CD133 and ALDH1 in invasive ductal breast carcinomas may be of help in more accurately predicting the aggressive properties and determining the optimal treatment.
26617768 Immunohistochemistry results indicate that combination with ALDH1 and STAT6 can improve the diagnostic value of CD34 for solitary fibrous tumors.
26517640 Cancer stem cell markers are variably expressed in prostate adenocarcinoma and immunohistochemical staining for ALDH1 and EZH2 may have a role in predicting tumour aggressiveness before treatment of prostate cancer
26462023 Data suggest that high expression of aldehyde dehydrogenase 1A1 (ALDH1A1) mRNA in tumor tissues may be an independent predictor of a favorable triple-negative breast cancer (TNBC) outcome.
26449187 salivary gland mucoepidermoid carcinomas contain a small population of cancer stem cells with enhanced tumorigenic potential and that are characterized by high ALDH activity and CD44 expression
26398662 Combined expression of ALDH1A1(high) and beta-catenin(c) was associated with lymph node metastasis, poor outcome, and resistance to cyclophosphamide treatment.
26358078 High expressions of ALDH1 is associated with lymph node metastasis in colorectal cancer.
More...

AA Sequence

MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQA      1 - 70
FQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKI     71 - 140
QGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIK    141 - 210
EAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLA    211 - 280
DADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQ    281 - 350
YDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR    351 - 420
ANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVK    421 - 490
TVTVKISQKNS                                                               491 - 501
//

Text Mined References (231)

PMID Year Title
27239845 [Abnormal expression of genes that regulate retinoid metabolism and signaling in non-small-cell lung cancer].
26896768 2016 Aldehyde dehydrogenase 1A1 stabilizes transcription factor Gli2 and enhances the activity of Hedgehog signaling in hepatocellular cancer.
26682730 2015 Prognostic Value of Cancer Stem Cell Marker ALDH1 Expression in Colorectal Cancer: A Systematic Review and Meta-Analysis.
26625750 2015 Clinicopathological Significance of CD133 and ALDH1 Cancer Stem Cell Marker Expression in Invasive Ductal Breast Carcinoma.
26617768 2015 Immunohistochemical evaluation of stem cell markers and signal transducer and activator of transcription 6 (STAT6) in solitary fibrous tumors.
26517640 2015 Cancer stem cell markers in prostate cancer: an immunohistochemical study of ALDH1, SOX2 and EZH2.
26462023 2015 ALDH1A1 mRNA expression in association with prognosis of triple-negative breast cancer.
26449187 2015 ALDH/CD44 identifies uniquely tumorigenic cancer stem cells in salivary gland mucoepidermoid carcinomas.
26398662 2015 Combined expression of aldehyde dehydrogenase 1A1 and ?-catenin is associated with lymph node metastasis and poor survival in breast cancer patients following cyclophosphamide treatment.
26358078 2016 Aldehyde Dehydragenase 1 and Nodal as Significant Prognostic Markers in Colorectal Cancer.
More...