Property Summary

NCBI Gene PubMed Count 124
Grant Count 56
R01 Count 38
Funding $6,688,657.07
PubMed Score 983.02
PubTator Score 280.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.200 0.005

Synonym

Accession P00338 B4DKQ2 B7Z5E3 D3DQY3 F8W819 Q53G53 Q6IBM7 Q6ZNV1 Q9UDE8 Q9UDE9 LDH-A
Symbols LDHM
GSD11
PIG19
HEL-S-133P

Gene

PANTHER Protein Class (2)

PDB

1I10   4AJP   4JNK   4L4R   4L4S   4M49   4OJN   4OKN   4QO7   4QO8   4QSM   4QT0   4R68   4R69   4RLS   4ZVV   5IXS   5IXY  

 GWAS Trait (1)

Gene RIF (91)

PMID Text
26989901 Multivariable analysis showed that combined expression of pyruvate kinase type M2 and lactate dehydrogenase A was an independent poor prognostic marker for survival.
26780311 Mammalian photoreceptors contain dimeric and tetrameric PKM2 and LDH-A. This is consistent with the ability to switch between energy production and biosynthesis like a proliferating tissue, possibly due to demands of opsin synthesis.
26721441 positive relationship between LDH-A expression and CSC/EMT markers was confirmed both in invasive bladder cell line and in 136 MIBC specimens.
26694942 Findings provide evidence of the cellular functions of lactate dehydrogenase A in the progression of glioblastoma and suggest that lactate dehydrogenase A might act as a potential therapeutic target for glioblastoma treatment.
26647830 IDO, through GCN2 kinase activation, downregulates the levels of TCRcomplex tchain and cMyc, resulting in the suppression of Tcell proliferation and a reduction in the levels of LDHA and GLS2
26484566 LDH and complex I play distinct roles in regulating glycolysis and cell proliferation. Inhibition of these two augments synthetic lethality in melanoma.
26261559 FOXM1-LDHA signaling functioned as a stimulator of glycolysis and promoted gastric cancer progression.
26254422 We propose a profibrotic feed forward loop, in which radiation induces LDHA expression and lactate production, which can lead to further activation of TGF-beta to drive the fibrotic process.
26062441 dehydrogenase A negatively regulated by miRNAs promotes aerobic glycolysis and is increased in colorectal cancer.
26014429 Reanalysis of genome-wide association study and in vitro validation show that lactate dehydrogenase interacts with branched-chain amino acid metabolism.
More...

AA Sequence

MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSL      1 - 70
FLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPV     71 - 140
DILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVS    141 - 210
LKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGL    211 - 280
YGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF                      281 - 332
//

Text Mined References (135)

PMID Year Title
26989901 2016 Pyruvate Kinase M2 and Lactate Dehydrogenase A Are Overexpressed in Pancreatic Cancer and Correlate with Poor Outcome.
26780311 2016 M-Type Pyruvate Kinase Isoforms and Lactate Dehydrogenase A in the Mammalian Retina: Metabolic Implications.
26721441 2016 LDH-A promotes malignant progression via activation of epithelial-to-mesenchymal transition and conferring stemness in muscle-invasive bladder cancer.
26694942 2016 Suppression of lactate dehydrogenase A compromises tumor progression by downregulation of the Warburg effect in glioblastoma.
26647830 2016 Indoleamine 2,3?dioxygenase downregulates T?cell receptor complex ??chain and c?Myc, and reduces proliferation, lactate dehydrogenase levels and mitochondrial glutaminase in human T?cells.
26484566 2015 Targeting metabolic flexibility by simultaneously inhibiting respiratory complex I and lactate generation retards melanoma progression.
26261559 2015 FOXM1-LDHA signaling promoted gastric cancer glycolytic phenotype and progression.
26254422 2015 Ionizing radiation induces myofibroblast differentiation via lactate dehydrogenase.
26062441 2015 Lactate dehydrogenase A negatively regulated by miRNAs promotes aerobic glycolysis and is increased in colorectal cancer.
26014429 2016 Reanalysis of mGWAS results and in vitro validation show that lactate dehydrogenase interacts with branched-chain amino acid metabolism.
More...