Property Summary

NCBI Gene PubMed Count 208
PubMed Score 366.05
PubTator Score 227.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -2.100 0.000
lung carcinoma -3.900 0.000
non-small cell lung carcinoma -1.300 0.000
psoriasis -1.500 0.000

Synonym

Accession P00326 Q4PJ18 Q5WRV0 Q6LBW4 Q6NWV0 Q6NZA7
Symbols ADH3

Gene

PANTHER Protein Class (2)

PDB

1DDA   1HT0   1U3W  

Gene RIF (220)

PMID Text
27239845 Even at early stages of malignant transformation, a significant decrease in ADH1B, ADH3, RDHL, and RALDH1 mRNA levels was observed in 82, 79, 73, and 64% of tumor specimens, respectively
26937962 Thus these findings suggest that the three variants of ADH1C, MnSOD and GSTM1 can be used to identify individuals who are at high risk to develop ALD and may be helpful in proper management of Indian alcoholics
26848198 the combination of genotypes ADH2 * 2, CYP2E1 * 1 combined with genotype homozygous ALDH2 * 1 found in this study could be leading to the population to a potential risk to alcoholism. The role of ADH3 was not indicated.
26634490 The ADH1C *1/*2 polymorphism is likely associated with pancreatitis risk.
26042511 ADH1B and ADH1C genetic variations are not related to the development of alcoholism or susceptibility to alcoholic cirrhosis.
25874489 ADH1B +3170A>G and ADH1C +13044A>G SNPs are associated with an increased risk of head and neck squamous cell carcinoma , and they could be used as biomarkers for the high-risk group of HNSCC in Koreans.
25524923 a positive association between inactive ADH1C G allele and alcohol consumption regarding gastric cancer risk was found, opposite to that found in previous studies
25503943 The study explores the association of ADH1B and ADH1C genotype with alcohol consumption and biomarkers of liver function.
25372623 findings suggest that ADH1C*2 is associated with alcohol dependence in the Turkish population displaying a dominant inheritance model. ADH1C*2 allele may contribute to the variance in heritability of alcohol dependence.
25311581 Among the Inuit in Greenland, ADH1C SNPs play a role in shaping their alcohol drinking patterns.
More...

AA Sequence

MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDEHVVSGNLVTPLPVILGHEA      1 - 70
AGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNPRGTLQDGTRRFTCSGKPIHH     71 - 140
FVGVSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFGLGGVGLSVVM    141 - 210
GCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASL    211 - 280
LCCHEACGTSVIVGVPPDSQNLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNI    281 - 350
LPFEKINEGFDLLRSGKSIRTVLTF                                                 351 - 375
//

Text Mined References (211)

PMID Year Title
27239845 [Abnormal expression of genes that regulate retinoid metabolism and signaling in non-small-cell lung cancer].
26937962 2016 Genetic Association and Gene-Gene Interaction Reveal Genetic Variations in ADH1B, GSTM1 and MnSOD Independently Confer Risk to Alcoholic Liver Diseases in India.
26848198 2015 Characterization of polymorphisms of genes ADH2, ADH3, ALDH2 and CYP2E1 and relationship to the alcoholism in a Colombian population.
26634490 2015 Association between alcohol dehydrogenase 1C gene *1/*2 polymorphism and pancreatitis risk: a meta-analysis.
26042511 2015 Genetic polymorphisms of ADH1B, ADH1C and ALDH2 in Turkish alcoholics: lack of association with alcoholism and alcoholic cirrhosis.
25874489 2015 Association between ADH1B and ADH1C polymorphisms and the risk of head and neck squamous cell carcinoma.
25524923 2015 Genetic polymorphisms of ADH1B, ADH1C and ALDH2, alcohol consumption, and the risk of gastric cancer: the Japan Public Health Center-based prospective study.
25503943 2014 ADH1B and ADH1C genotype, alcohol consumption and biomarkers of liver function: findings from a Mendelian randomization study in 58,313 European origin Danes.
25372623 2015 Association between ADH1C and ALDH2 polymorphisms and alcoholism in a Turkish sample.
25311581 2014 Genetic variation in alcohol metabolizing enzymes among Inuit and its relation to drinking patterns.
More...