Property Summary

Ligand Count 2
NCBI Gene PubMed Count 211
PubMed Score 381.54
PubTator Score 227.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -1.300 2.0e-07
lung carcinoma -3.900 2.3e-34
non-small cell lung carcinoma -1.300 2.3e-08
psoriasis -1.500 6.8e-14

Protein-protein Interaction (2)

Gene RIF (223)

AA Sequence

MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDEHVVSGNLVTPLPVILGHEA      1 - 70
AGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNPRGTLQDGTRRFTCSGKPIHH     71 - 140
FVGVSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFGLGGVGLSVVM    141 - 210
GCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASL    211 - 280
LCCHEACGTSVIVGVPPDSQNLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNI    281 - 350
LPFEKINEGFDLLRSGKSIRTVLTF                                                 351 - 375
//

Text Mined References (214)

PMID Year Title