Property Summary

Ligand Count 4
NCBI Gene PubMed Count 350
PubMed Score 381.54
PubTator Score 398.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count
Alcohol dependence 107

Expression

  Differential Expression (26)

Disease log2 FC p
acute quadriplegic myopathy 2.428 4.2e-04
adrenocortical adenoma -1.492 4.7e-02
adrenocortical carcinoma -4.848 9.0e-09
aldosterone-producing adenoma -1.299 3.4e-02
Atopic dermatitis -3.600 2.1e-04
Breast cancer -3.600 2.8e-02
breast carcinoma -3.000 5.1e-24
colon cancer -4.100 1.2e-02
ductal carcinoma in situ -4.000 8.0e-05
esophageal adenocarcinoma -1.300 1.8e-02
fibroadenoma -1.700 2.0e-02
intraductal papillary-mucinous adenoma (... -4.500 2.2e-04
intraductal papillary-mucinous carcinoma... -6.300 2.5e-06
intraductal papillary-mucinous neoplasm ... -6.400 1.7e-04
invasive ductal carcinoma -2.518 1.1e-02
lung adenocarcinoma -2.500 2.2e-10
lung cancer -5.000 2.3e-07
lung carcinoma -4.700 4.5e-35
nasopharyngeal carcinoma -1.400 1.6e-03
non primary Sjogren syndrome sicca 1.400 1.3e-02
non-small cell lung cancer -6.012 4.4e-32
ovarian cancer -7.900 4.1e-24
pancreatic cancer -1.900 2.2e-03
pituitary cancer -3.800 2.7e-09
primary pancreatic ductal adenocarcinoma -1.045 4.0e-02
psoriasis -2.000 1.3e-03

Protein-protein Interaction (2)

Gene RIF (376)

AA Sequence

MSTAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICRTDDHVVSGNLVTPLPVILGHEA      1 - 70
AGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLGNPRGTLQDGTRRFTCRGKPIHH     71 - 140
FLGTSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAVM    141 - 210
GCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASL    211 - 280
LCCHEACGTSVIVGVPPASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV    281 - 350
LPFEKINEGFDLLHSGKSIRTVLTF                                                 351 - 375
//

Text Mined References (353)

PMID Year Title