Property Summary

NCBI Gene PubMed Count 330
PubMed Score 366.05
PubTator Score 398.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
lung carcinoma 2844 4.48130873490861E-35
non-small cell lung cancer 2798 9.26911718389676E-33
breast carcinoma 1614 2.5255892763827E-28
ovarian cancer 8492 2.5266262430424E-24
pituitary cancer 1972 7.84175434289876E-10
adrenocortical carcinoma 1427 2.62593454850034E-9
lung cancer 4473 7.39801890061025E-8
lung adenocarcinoma 2714 1.49013211617014E-6
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.5175095898521E-6
ductal carcinoma in situ 1745 7.96624710004792E-5
colon cancer 1475 1.43480788765264E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 1.66635803860098E-4
psoriasis 6685 1.99417664529826E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.23749345026594E-4
Atopic dermatitis 944 4.75618074110233E-4
invasive ductal carcinoma 2950 5.78834308771764E-4
nasopharyngeal carcinoma 1056 0.00159013507983193
acute quadriplegic myopathy 1157 0.00166905693187852
pancreatic cancer 2300 0.00339375703840175
non primary Sjogren syndrome sicca 840 0.0128464456307274
esophageal adenocarcinoma 737 0.018385476472012
fibroadenoma 557 0.0200616393334664
Breast cancer 3099 0.0321271666600933
aldosterone-producing adenoma 664 0.0337969886464421
primary pancreatic ductal adenocarcinoma 1271 0.0402785101222286
adrenocortical adenoma 134 0.0465910744828033
Disease Target Count
Alcohol dependence 107

Expression

Synonym

Accession P00325 A8MYN5 B4DRS9 B4DVC3 Q13711 Q4ZGI9 Q96KI7
Symbols ADH2
HEL-S-117

Gene

PANTHER Protein Class (2)

PDB

1DEH   1HDX   1HDY   1HDZ   1HSZ   1HTB   1U3U   1U3V   3HUD  

  Ortholog (1)

Species Source
Chimp OMA Inparanoid

Gene RIF (356)

PMID Text
27239845 Even at early stages of malignant transformation, a significant decrease in ADH1B, ADH3, RDHL, and RALDH1 mRNA levels was observed in 82, 79, 73, and 64% of tumor specimens, respectively
26848198 the combination of genotypes ADH2 * 2, CYP2E1 * 1 combined with genotype homozygous ALDH2 * 1 found in this study could be leading to the population to a potential risk to alcoholism.
26284938 The presence of the ADH1B*2 allele and the active ALDH2*1/*1 genotype increased the odds ratio for a high TG level.
26042511 ADH1B and ADH1C genetic variations are not related to the development of alcoholism or susceptibility to alcoholic cirrhosis.
26036284 modulates alcohol consumption [meta-analysis]
26033520 ADH1B polymorphisms may be related to comorbid bipolar II disorder and alcohol dependence.
25994345 suggested that having the ADH1B*2/*2 genotype caused a positive reaction in subjects with the ALDH2*1/*1 genotype
25874489 ADH1B +3170A>G and ADH1C +13044A>G SNPs are associated with an increased risk of head and neck squamous cell carcinoma , and they could be used as biomarkers for the high-risk group of HNSCC in Koreans.
25830378 a central role for ADH1B in obesity and insulin resistance
25543168 ADH1B and (ALDH2) polymorphisms in Japanese employees were associated with increased risk for anxiety and depression and alcohol-related disorders.
More...

AA Sequence

MSTAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICRTDDHVVSGNLVTPLPVILGHEA      1 - 70
AGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRVCKNPESNYCLKNDLGNPRGTLQDGTRRFTCRGKPIHH     71 - 140
FLGTSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVNVAKVTPGSTCAVFGLGGVGLSAVM    141 - 210
GCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASL    211 - 280
LCCHEACGTSVIVGVPPASQNLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV    281 - 350
LPFEKINEGFDLLHSGKSIRTVLTF                                                 351 - 375
//

Text Mined References (333)

PMID Year Title
27239845 [Abnormal expression of genes that regulate retinoid metabolism and signaling in non-small-cell lung cancer].
26848198 2015 Characterization of polymorphisms of genes ADH2, ADH3, ALDH2 and CYP2E1 and relationship to the alcoholism in a Colombian population.
26284938 2015 Alcohol Dehydrogenase-1B (rs1229984) and Aldehyde Dehydrogenase-2 (rs671) Genotypes Are Strong Determinants of the Serum Triglyceride and Cholesterol Levels of Japanese Alcoholic Men.
26042511 2015 Genetic polymorphisms of ADH1B, ADH1C and ALDH2 in Turkish alcoholics: lack of association with alcoholism and alcoholic cirrhosis.
26036284 2015 Genomewide Association Study for Maximum Number of Alcoholic Drinks in European Americans and African Americans.
26033520 2015 Comorbid alcohol dependence disorder may be related to aldehyde dehydrogenase 2 (ALDH2) and alcohol dehydrogenase 1B (ADH1B) in bipolar II disorder, but only to ALDH2 in bipolar I disorder, in Han Chinese.
25994345 2015 [Associations between ALDH2 and ADH1B Genotypes and Ethanol-Induced Cutaneous Erythema in Young Japanese Women].
25874489 2015 Association between ADH1B and ADH1C polymorphisms and the risk of head and neck squamous cell carcinoma.
25830378 2015 Transcriptomic identification of ADH1B as a novel candidate gene for obesity and insulin resistance in human adipose tissue in Mexican Americans from the Veterans Administration Genetic Epidemiology Study (VAGES).
25543168 2015 Genetic alcohol sensitivity regulated by ALDH2 and ADH1B polymorphisms is strongly associated with depression and anxiety in Japanese employees.
More...