Property Summary

NCBI Gene PubMed Count 63
PubMed Score 1711.67
PubTator Score 49.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (23)

Disease log2 FC p
acute myeloid leukemia -2.400 4.7e-02
adrenocortical adenoma -1.795 5.7e-03
adrenocortical carcinoma -1.735 2.7e-05
aldosterone-producing adenoma -1.922 1.2e-02
Atopic dermatitis -1.200 2.3e-03
chronic rhinosinusitis -1.296 1.0e-02
cystic fibrosis 1.015 1.4e-04
dermatomyositis 1.100 3.3e-03
gastric carcinoma -1.100 2.1e-02
interstitial cystitis -1.800 8.3e-04
intraductal papillary-mucinous carcinoma... -1.200 4.4e-03
intraductal papillary-mucinous neoplasm ... -1.300 5.5e-03
lung adenocarcinoma -1.500 1.3e-06
lung cancer -2.300 4.0e-06
lung carcinoma -2.200 2.8e-31
malignant mesothelioma -3.100 3.4e-08
non primary Sjogren syndrome sicca 1.100 1.5e-02
non-small cell lung cancer -1.646 2.6e-17
ovarian cancer -2.100 2.3e-07
pancreatic cancer -1.100 1.7e-03
pancreatic ductal adenocarcinoma liver m... -2.984 1.9e-03
Polycystic ovary syndrome 1.064 3.2e-02
psoriasis 1.200 8.3e-04

Gene RIF (30)

AA Sequence

MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHST      1 - 70
DAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED           71 - 134
//

Text Mined References (68)

PMID Year Title