Property Summary

NCBI Gene PubMed Count 58
PubMed Score 1711.17
PubTator Score 49.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung carcinoma 2844 2.77680485220788E-31
non-small cell lung cancer 2798 2.14332718983238E-17
malignant mesothelioma 3163 3.57669963960708E-9
ovarian cancer 8492 2.27776224335142E-7
lung adenocarcinoma 2714 1.29622552124425E-6
interstitial cystitis 2299 4.05853414845786E-6
lung cancer 4473 6.6591827260765E-6
adrenocortical carcinoma 1427 3.95959457409803E-5
dermatomyositis 967 5.40156031439021E-4
psoriasis 6685 8.32224690400352E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00119120943938076
pancreatic cancer 2300 0.00224597434435825
Atopic dermatitis 944 0.00228217061931817
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00268315007929361
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00415005069779788
adrenocortical adenoma 134 0.00487843264580747
chronic rhinosinusitis 512 0.00800706504388131
non primary Sjogren syndrome sicca 840 0.0137608094129505
aldosterone-producing adenoma 664 0.0157583781709915
gastric carcinoma 832 0.0232723642739337
Polycystic Ovary Syndrome 335 0.0315287100120476
cystic fibrosis and chronic rhinosinusitis 213 0.0352825803359935
acute myeloid leukemia 785 0.0466041439683689
Disease Target Count
Methemoglobinemia CYB5A-related 1

Expression

Synonym

Accession P00167 A8MV91 F8WEU4 Q6IB14
Symbols CYB5
MCB5

Gene

PANTHER Protein Class (2)

PDB

2I96  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (25)

PMID Text
26587646 We conclude that cytochrome b5 can influence the electronic conductivity of cytochrome P450c17 via allosteric, protein-protein interactions.
25890314 CYB5A is the first RA susceptibility gene involved in androgen synthesis. Our functional analysis of SNP rs1790834 indicates that it contributes to the sex bias observed in RA.
25315771 Two acidic residues, Glu-48 and Glu-49, of cytochrome b5 are essential for stimulating the 17,20-lyase activity of CYP17A1.
25225034 Variants in CYB5A and CYB5R3 should be considered in the evaluation of breast cancer risk in African American women.
24832628 both area and ratio of 3betaHSD and CYB5A double positive cells, which could represent the hybrid cells of zona fasciculate and zona reticularis, are correlated with adrenal development and could influence age-related serum androstenedione levels.
24448000 raises the possibility that inhibition of CYB5A-deregulated downstream pathways, such as those involving TRAF6, may favor autophagy-mediated cancer cell death in selected subgroups of patients
24319746 Cytochrome b5 seems to play the key role in the formation of lipid-radical cycles in membranes.
24301457 Results define CYB5A as a novel prognostic factor for PDAC that exerts its tumor-suppressor function through autophagy induction and TRAF6 modulation.
24151200 CYB5A, which has a role in stearyl-CoA-desaturase activity, and RNF10, with an unknown role in weight regulating pathways, associated with adiposity and nominally increased the risk for T2D in American Indians.
23620596 CYP17A1/b5 interaction is stronger when the hydroxylase substrate pregnenolone is present in the CYP17A1 active site than when the lyase substrate 17alpha-hydroxypregnenolone is in the active site.
More...

AA Sequence

MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHST      1 - 70
DAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED           71 - 134
//

Text Mined References (63)

PMID Year Title
26587646 2015 Mechanistic Scrutiny Identifies a Kinetic Role for Cytochrome b5 Regulation of Human Cytochrome P450c17 (CYP17A1, P450 17A1).
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25890314 2015 CYB5A polymorphism increases androgens and reduces risk of rheumatoid arthritis in women.
25315771 2014 Catalytically relevant electrostatic interactions of cytochrome P450c17 (CYP17A1) and cytochrome b5.
25225034 2014 Polymorphisms in the carcinogen detoxification genes CYB5A and CYB5R3 and breast cancer risk in African American women.
24832628 2015 3?HSD and CYB5A double positive adrenocortical cells during adrenal development/aging.
24448000 2014 CYB5A and autophagy-mediated cell death in pancreatic cancer.
24319746 2013 Role of cytochrome b5 and ?-tocopherol to microsomal and mitochondrial oxidation.
24301457 2014 Role of CYB5A in pancreatic cancer prognosis and autophagy modulation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...