Property Summary

NCBI Gene PubMed Count 1
Grant Count 150
R01 Count 83
Funding $16,520,616.98
PubMed Score 5676.02
PubTator Score 2675.29

Knowledge Summary

Patent

No data available

Expression

Gene

Gene RIF (22)

PMID Text
26626315 These results indicate that miR-151a-5p may participate in the regulation of cellular respiration and ATP production through targeting Cytb.
26566881 Mitochondrial mutation m.15804T>C in the mtCYB gene in a family with fibromyalgia is associated with NLRP3-inflammasome activation.
24103151 The polymorphisms of CYTB as a very useful DNA marker were significantly different between different geographical Uyghur
24102627 This study suggests that, in part, polymorphisms in the MT-ATP6 and MT-CYB genes may contribute to the unexpected fertilization failure.
21506659 Significant elevation of ERalpha and MTCYB transcript levels in premenopausal leiomyomas and its association with ERalpha, -397 CC genotype suggests the mitochondrial-mediated role of estrogen as the promoter of leiomyoma tumorigenesis.
21389643 Data show that homoplasmic G6709A (MT-CO1) and G14804A (MT-CYB) alterations cause amino acid changes in the highly conserved residues.
19758471 Observational study of gene-disease association. (HuGE Navigator)
19570036 Trx2 overexpression modulates the mRNA levels of the COX1 (cytochrome oxidase subunit I) and Cytb (cytochrome b), which are known to be regulated by GR and NF-kappaB.
19569044 cytochrome B gene mutation induces mitochondrial proliferation and prevents apoptosis in human uroepithelial SV-HUC-1 cells.
19563916 The m.15635T>C transition (S297P) was carried by a newborn who presented with a polyvisceral failure.
More...

AA Sequence

MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDASTAFSSIAHIT      1 - 70
RDVNYGWIIRYLHANGASMFFICLFLHIGRGLYYGSFLYSETWNIGIILLLATMATAFMGYVLPWGQMSF     71 - 140
WGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFTFHFILPFIIAALATLHLLFLHETGSNNPLG    141 - 210
ITSHSDKITFHPYYTIKDALGLLLFLLSLMTLTLFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLFAYTI    211 - 280
LRSVPNKLGGVLALLLSILILAMIPILHMSKQQSMMFRPLSQSLYWLLAADLLILTWIGGQPVSYPFTII    281 - 350
GQVASVLYFTTILILMPTISLIENKMLKWA                                            351 - 380
//

Text Mined References (24)

PMID Year Title
26566881 2016 Mutation in cytochrome b gene of mitochondrial DNA in a family with fibromyalgia is associated with NLRP3-inflammasome activation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
12905068 2003 Association of the mitochondrial DNA 15497G/A polymorphism with obesity in a middle-aged and elderly Japanese population.
12022039 2002 Mitochondrial genome diversity of Native Americans supports a single early entry of founder populations into America.
11891837 2002 Septo-optic dysplasia associated with a new mitochondrial cytochrome b mutation.
11601507 2001 Multisystem disorder associated with a missense mutation in the mitochondrial cytochrome b gene.
11553319 2001 Major genomic mitochondrial lineages delineate early human expansions.
11464242 2001 Functional characterization of novel mutations in the human cytochrome b gene.
11130070 2000 Mitochondrial genome variation and the origin of modern humans.
More...