Property Summary

NCBI Gene PubMed Count 211
PubMed Score 741.42
PubTator Score 531.43

Knowledge Summary

Patent (26,702)

TINX Plot

  Disease (5)

Expression

  Differential Expression (18)

Disease log2 FC p
pancreatic cancer 1.100 3.9e-04
malignant mesothelioma 2.200 3.5e-08
glioblastoma multiforme 1.200 1.3e-07
posterior fossa group B ependymoma -2.000 4.0e-08
group 4 medulloblastoma -2.200 5.4e-04
medulloblastoma, large-cell -2.100 4.7e-03
primitive neuroectodermal tumor -1.700 9.6e-03
intraductal papillary-mucinous neoplasm ... 1.700 4.5e-02
breast carcinoma -3.400 4.4e-35
Breast cancer -4.900 2.8e-66
pilocytic astrocytoma 1.200 2.5e-02
pancreatic carcinoma 1.100 3.9e-04
nasopharyngeal carcinoma -1.300 1.1e-03
ductal carcinoma in situ -2.300 4.9e-02
ovarian cancer 2.000 3.4e-04
chronic rhinosinusitis -1.964 2.9e-02
head and neck cancer -2.200 3.2e-02
non-small cell lung cancer and chronic o... -1.600 1.2e-02

MLP Assay (10)

AID Type Active / Inconclusive / Inactive Description
2435 screening 1044 / 0 / 323814 Fluorescence-based primary cell-based high throughput screening assay to identify agonists of the Oxytocin Receptor (OXTR).
2445 screening 199 / 0 / 324659 Fluorescence-based primary cell-based high throughput screening assay to identify potentiators of Oxytocin Receptor (OXTR)
2481 summary 0 / 0 / 0 Summary of probe development efforts to identify potentiators of Oxytocin Receptor (OXTR)
2482 summary 0 / 0 / 0 Summary of probe development efforts to identify agonists of Oxytocin Receptor (OXTR)
434963 screening 65 / 0 / 321 Fluorescence-based cell-based high throughput confirmation assay for agonists of the Oxytocin Receptor (OXTR)
434969 screening 22 / 0 / 153 Counterscreen for vasopressin 1 receptor (V1R) agonists: Fluorescence-based cell-based high throughput screening assay to identify agonists of the Oxytocin Receptor (OXTR)
434985 screening 6 / 0 / 177 Fluorescence-based cell-based high throughput confirmation assay to identify potentiators of Oxytocin Receptor (OXTR)
463103 confirmatory 2 / 0 / 20 Fluorescence-based cell-based high throughput dose response assay for agonists of the Oxytocin Receptor (OXTR)
463125 confirmatory 0 / 0 / 5 Fluorescence-based cell-based high throughput dose response assay for potentiators of Oxytocin Receptor (OXTR)
463128 confirmatory 3 / 0 / 9 Counterscreen for vasopressin 1 receptor (V1R) agonists: Fluorescence-based cell-based high throughput dose response assay for agonists of the Oxytocin Receptor (OXTR)

Gene RIF (210)

PMID Text
27015428 on N170 were evident. Those effects were present in the first and in the second study. Whereas we found molecular-genetic associations of oxytocinergic polymorphisms with the N170 in the first study, we failed to do so in the replication sample
26903639 Data show that oxytocin receptor and estrogen receptor beta single nucleotide polymorphisms (SNPs) temper accelerated cellular aging in young females who tend to make impatient choices.
26738630 estimation of the gender and population differences in polymorphisms of two oxytocin receptor gene SNPs, rs53576 and rs2254298, in four populations
26599592 These findings suggest that genetic variations in the oxytocin receptor gene may not explain a significant part of alexithymia in patients with obsessive-compulsive disorder.
26506050 Variants of OXTR have been linked to individual differences in psychological and physiological response patterns to stress and social information.
26488131 The OXTR rs53576 genotype and attachment style are on social anxiety possibly constituting a targetable combined risk marker of social anxiety disorder.
26477647 The found of this study underscore a series of relations among a common oxytocin receptor gene variant, early life stress exposure, and structure and function of the amygdala in early life.
26444016 results indicate that the OXTR genotype affects attitudinal trust as part of an individual's relatively stable disposition, and further affects behavioral trust through changes in attitudinal trust.
26406593 Results show that genetic variants in the oestrogen receptor alpha and the oxytocin receptor may be associated with an increased risk of oesophageal adenocarcinoma and Barrett's oesophagus.
26389606 there was no evidence that OXTR rs53576 moderated the association between attachment security during early childhood and overall coherence of mind ("security") during the Adult Attachment Interview at age 18 years.
26365303 In this study, authors examine the association between the OXTR gene and a specific social phenotype within ASD
26241486 The study tested the hypothesis that variation in the oxytocin receptor gene (OXTR rs53576) and self-report of rejection sensitivity are associated with adrenocortical reactivity to social stress.
26228411 The oxytocin receptor (OXTR, rs53576) was associated with increased risk for comorbid depressive and disruptive behavior disorders.
26178189 sex differences in oxytocin effects on social cooperation are specific to individuals with OXTR rs53576 GG genotype.
26121678 genetic variation in the rs53576 influences general sociality; however, the study did not detect significant genetic association between rs53576 and close relationships (Cohen's d = 0.01, p = .64)(Meta-Analysis)
26110343 data suggest that G allele carriers of the OXTR might be more vulnerable to panic and major depressive disorder.
26106053 OXTR polymorphisms may be a useful intermediate endophenotype to consider in the treatment of patients with anorexia nervosa.
26061800 Low maternal care in childhood was associated with greater DNA methylation in an OXTR target sequence in blood cells in adulthood.
25977357 Using a family-based association design, it was suggestive that a particular OXTR variant (rs11131149) interacted with maternal cognitive sensitivity on children's ToM
25968600 Study identified, in OXTR and AVPR1A genes, signatures of balancing selection in the cis-regulative acting sequences such as transcription factor binding and enhancer sequences, as well as in a transcriptional repressor sequence motif. Additionally, in the intron 3 of the OXTR gene, the SNP rs59190448 appears to be under positive directional selection.
25935637 variation in the OXTR gene was found to interact with 2D:4D to predict men's (but not women's) performance in a cognitive empathy task.
25890851 This study suggests that OXTR exon 1 methylation in particular is associated with phenotype traits such as depression.
25773927 a positive association between the G allele of OXTR rs53576 and bulimia nervosa
25687563 Fetal membranes from preterm birth show differences in OXTR methylation, regulation and expression. Epigenetic alteration of this gene in preterm birth fetal membrane may be indicating an in utero programing and a link to autism spectrum disorders.
25680993 there were stronger associations between interdependence and empathic neural responses in the insula, amygdala and superior temporal gyrus in G/G compared with A/A carriers.
25675509 variability in OXTR methylation impacts social perceptual processes often linked with oxytocin, such as perception of facial emotions.
25646574 The present study investigated the association between the rs2268498 polymorphism on the OXTR gene and social perception abilities as measured by the interpersonal perception.
25640833 Religion impacts self-control in a social context, and whether this effect differs depending on the genotype of an oxytocin receptor gene (OXTR) polymorphism (rs53576).
25637390 two variants of OXTR rs53576 are associated with racial ingroup bias in brain activities that are linked to implicit attitude and altruistic motivation
25627343 In normal uteri, the expression of oxytocin The expression pattern of oxytocin receptor in the normal junctional zone of the uterus is disrupted in women with adenomyosis.
25622005 boys and girls of depressed mothers who carried the Oxytocin Receptor rs53576 GG genotype exhibited increased sensitivity for sad faces and decreased sensitivity for happy faces.
25593022 OXT activation of the OXTR occurs in the posterior retina and that this may serve as a paracrine signaling pathway that contributes to communication between the cone photoreceptor and the RPE.
25564674 The data support the view that the presence of the G allele of OXTR not only promotes prosocial behaviors but also favors sensitivity to a negative social stressor
25563749 Results suggest that OXTR hypomethylation is associated with social anxiety disorder (SAD) and social phobia-related traits potentially reflecting a decreased oxytocin tone to be pathogenetically relevant in SAD
25476609 examined associations between polymorphisms in OXTR and AVPR1a and individual differences in emotional and cognitive empathy 367 young adults; emotional empathy was associated solely with OXTR, whereas cognitive empathy was associated solely with AVPR1a
25419912 Mothers' OXTR genotype predicted her warmth toward her children, even after controlling for child genotype. This association was not found for fathers.
25326040 OXTR variation modulates levels of social support via proximal impacts on individual temperament.
25309987 Carriers of both the T allele of OXTR rs1042778 and the C allele of clock rs1801260 showed the lowest total prosocial tendency scores compared with the other groups. the clock gene and OXT/AVP systems are intertwined and contribute to human prosociality.
25262417 These results support the hypothesis that the oxytocin system plays a role in the pathophysiology of mood and anxiety disorders
25244972 The findings of this study provided preliminary support for the involvement of genetic variants of the OXTR in social cognitive impairments in schizophrenia.
25199917 First longitudinal study to examine the role of environmental risk exposure and OXTR methylation in the development of callous-unemotional traits for youth low vs high in internalizing problems
25092245 This current meta-analysis demonstrated that the association of OXTR with autism spectrum disorder and the findings suggest directions for future studies of the etiology of autism spectrum disorder.
25047302 In children with borderline personality symptoms, there were significant maltreatment X OXTR X gender interactions.
25003328 OXTR polymorphism interacts with social stress to predict antisocial outcomes in at-risk adolescents.
25001970 OXTR rs53576 is connected with the striatal Dopamine transporter availability in vivo and modulates the interactions between the oxytocinergic and dopaminergic systems.
24916666 variability in rs11131149 was significantly associated with social cognition.
24836510 study does not support the contribution of rare non-synonymous OXTR variations to ASD susceptibility in the Japanese population.
24814480 the combination of rs2254298(A/G) and rs53576(G/G)in oxytocin receptor gene confers a deleterious effect on social cognition
24749639 Mothers and GG allele carriers of the OXTR gene showed an early latency (~100 ms) differential frontal ERP response to strong intensity facial expressions, and mothers also showed modulation of the posterior EPN waveform by negative valence.
24703166 OXTR genotype may partially account for the transmission of maternal depression to youth and support the role of dysfunctional social processes
24660771 Women, but not men, with high levels of poststressor OT and the GG genotype of rs53576 felt the most positive affect after the stressor.
24621820 personality, behavior and environmental features associated with OXTR genetic variants
24618689 Early caregiving combined with genetic liability along the axis of vasopressin-oxytocin gene pathways: G x E contributions to PTSD.
24523928 Epigenetic misregulation of the OXTR gene may be implicated in anorexia nervosa
24458227 results do not contradict the hypothesis of associations between personality traits and oxytocin-related gene variants; however, there are no statistically significant associations after correcting for multiple testing.
24454713 gene-behavior association analysis suggests that oxytocin receptor gene polymorphisms have an impact in both breeds on (i) proximity seeking towards an unfamiliar person, as well as their owner, and on (ii) how friendly dogs behave towards strangers
24393355 findings obtained from an imaging-genetics approach provided preliminary evidence for the association between OXTR and neuronal function in the MTL in ASD individuals.
24367110 A common SNP in the oxytocin receptor (rs237887) was strongly associated with recognition memory in combined probands, parents, and siblings after correction for multiple comparisons.
24295535 These findings support the importance of the oxytocin receptor variation in emotional and physiological reactions to the affective experiences of other conspecifics
24223720 A relation was found between the OXTR rs53576 variant and state loneliness, in girls only.
24209975 A significant gender-heterogeneous effect was identified in one OXTR SNP on dichotomized social connectedness; rs4686302 T allele was nominally associated with social connectedness in men, whereas the association direction was opposite in women
24128365 Carriers of the T-allele exhibited more accurate recognition skills than subjects carrying the CC-genotype
24120094 Findings suggest that the OXTR-genotype rs237915 moderates risk for social and emotional problems after stressful experiences and that this effect is partly mediated by genotype-dependent sensitivity to the reinforcement value of negative social cues
24059750 We conclude that polymorphic variation of the OXTR characterizes children with high levels of callous-unemotional traits and conduct problems.
23974948 The results of this study the OXTR as potential biomarkers for research on disorders of social dysfunction and the neurobiology of empathy.
23946005 These results show that decreased volume of the insula is a neuroanatomical correlate of ALTs and a potential intermediate phenotype linking autistic-like traits with OXTR in male subjects.
23921259 Two of the most intensively studied OXTR SNPs (rs53576 and rs2254298) failed to explain a significant part of human social behavior.
23915847 Recent progress in molecular biology has augmented our knowledge about OTR regulation in the uterus at the transcription level, although the totality of preparation for labor through OTR expression is still obscure.
23889750 Maternal OXTR missense single nucleotide polymorphisms rs4686302 and rs237902 may have gestational age-dependent effects on prematurity.
23863476 Genotype differences in a polymorphism in the oxytocin receptor gene rs1042778 predicted creative ideation in young adults
23838880 The relations between OXTR and loneliness were examined, as well as interactions between OXTR and sex, parental support, 5-HTTLPR genotype, and DRD2 genotype.
23731038 The continuity of attachment security from infancy into young adulthood is moderated by OXTR genetic variation.
23708061 The results of this study highlight possible neural pathway by which a naturally occurring variation of the OXTR gene may affect an anxiety-related temperamental trait in female subjects by modulating prefrontal-amygdala functional connectivity.
23684879 Our findings identify gender-dependent mechanisms of OXTR rs53576 gene variation impacting the functional connectivity of the hypothalamus in healthy individuals
23678036 Data from cultured myometrial cells from pregnant women undergoing elective cesarean section suggest that PGF2alpha increases expression of OTR in lower segment of uterus and decreases expression of OTR in the upper segment.
23653389 Dysfunctional labor patterns and increased oxytocin utilization seen in obese women may not be due to differences in OXTR expression.
23637833 OXTR SNP rs237885 did not associate with maternal behavior, but it did associate with pre-natal (but not post-natal) depression score.
23562248 Initial evidence that the capacity to respond to suggestions for altered internal experience (hypnosis) is influenced by the oxytocin receptor gene.
23547247 Study revealed that three specific haplotypes on OXTR were associated with emotional reactions after an experimental betrayal of trust in an iterated Prisoner's Dilemma Game
23470776 The functioning of females was most affected by negative social environments regardless of stress, whereas the functioning of males was differentially susceptible to stress depending on OXTR genotype and negative social environments
23355275 Oxytocin receptor, but not connexin-43, expression is related to BMI, suggesting an alteration in oxytocin receptor expression or function related to obesity
23354128 Oxytocin receptor gene and prosocial behavior interaction modulates the association between stress and physical health.
23284802 Our preliminary findings support hypotheses about an involvement of OXTR rs2254298 in emotional empathy in schizophrenic and healthy individuals, warranting independent replication.
23252931 The present study did not provide supportive evidence for the contribution of OXTR to susceptibility to schizophrenia in a Japanese population.
23219106 supportive evidence for the association between OXTR and the clinical phenotypes of autism spectrum disorders
23089921 A combination of three oxytocin receptor gene polymorphisms is associated with an increased risk for preterm birth.
23040540 We conclude that molecular studies are warranted to elucidate functional consequences of OXTR variants that have shown stable associations with sociobehavioral phenotypes
22999795 Oxytocin receptor overexpression in myometrial smooth muscle cells may be responsible for increased uterine contractility and adenomyosis-associated dysmenorrhea.
22986294 this mini-review integrates recent accumulating evidence about human behavioral and neural correlates of OXTR--REVIEW
22892716 Decrease in DNA methylation of the OXTR and subsequent increase in expression may be a potential mechanism supporting physiological recovery after acute stress on an epigenetic level.
22882465 study found a heterozygote effect on one SNP in the oxytocin receptor gene (rs75775), so that individuals heterozygous for this SNP had elevated risk for premature ejaculation symptoms compared with carriers of either homozygote
22809402 This study adds further evidence to the hypothesis that genetic variations in the OXTR modulate mind-reading and social behaviour.
22763666 Infants' faces were more strongly preferred following oxytocin inhalation; this effect was only observed for participants homozygous for the OXTR rs53576G genotype
22651577 Oxytonergic gene variants appear to be involved in schizophrenia vulnerability.
22563705 Mothers with the GG genotype of OXTR rs53576 show greater differential maternal sensitivity across varying levels of interparental conflict.
22510359 The present review article seeks to further strengthen the argument in favour of the differential susceptibility theory by incorporating findings from behavioural and neuroanatomical studies in relation to genetic variation of the oxytocin receptor gene. [Review]
22487732 We did not observe any association between the genotypes or alleles of the selected SNPs within COX-2 and OXTR genes and treatment resistance, response and remission in the whole sample
22457427 greater perceived threat predicted engagement in fewer charitable activities for individuals with A/A and A/G genotypes of OXTR rs53576, but not for G/G individuals
22421562 the region of the OXTR gene including both the rs4564970 and the rs1488467 polymorphisms may be involved in the regulation of the relationship between alcohol and aggression as well as between alcohol and the propensity to react to situations with anger.
22372486 OXTR single nucleotide polymorphisms rs6770632 and rs1042778 may be associated with extreme, persistent and pervasive aggressive behaviours in females and males, respectively.
22357335 natural variants of OXTR associated with trait empathy; specifically, individuals with certain OXTR genotype did perform better on trait empathy, while others did not
22336563 Reduced plasma oxytocin and both OXTR and CD38 risk alleles were related to less parental touch
22296985 participants were genotyped for a functional polymorphism (rs2268498) in the promoter region of the OXTR gene. carriers of the C-allele rated accidentally committed harm as significantly more blameworthy than non-carriers
22294460 However, the haplotype consisting of the OXTR_rs237885 A allele and OXTR_rs2268493 A allele was associated with significantly higher callous-unemotionals cores than other haplotypes.
22212599 Oxytocin receptor (OXTR) is not associated with optimism
22146101 Oxytocin receptor A carrier males had higher levels of resting sympathetic cardiac control as compared to their G/G counter parts. However, G/G participants displayed significantly higher levels of sympathetic reactivity topsychological stress.
22123970 A common single nucleotide polymorphism (rs53576) in the oxytocin receptor gene (OXTR) might interact with stress-protective effects of social support.
22084107 Individuals homozygous for the G allele of OXTR were judged to be more prosocial than carriers of the A allele.
22015110 results suggest an association between variation in OXTR and human pair-bonding and other social behaviors.
21984889 [review] The distribution of the OT receptor (OTR) system in both the brain and periphery is far-reaching and its expression is subject to changes over the course of development.
21964067 The present demonstration of a novel beta(2)adrenergic receptor-coupled signalling pathway that is dependent on oxytocin receptor co-expression is suggestive of a molecular interaction between the two receptors
21963428 physical interactions between oxytocin receptor and beta(2)adrenergic receptor in the context of a new heterodimer pair lie at the heart of observed allosteric effects
21934640 concluded that in this sample, 10 SNPs in the OXTR gene were not significantly associated with conduct disorder
21896752 The effects of OXTR on depressive symptoms may be largely mediated by the influence of OXTR on psychological resources.
21876222 Comparative analysis of human and canine OXTR amino acid sequence revealed that the biggest difference between the two proteins is a five-amino-acid fragment, which is present in the human but absent in the canine receptor.
21734268 The synergistic regulation of human oxytocin receptor promoter by CCAAT/ enhancer-binding protein and RELA may play a role in the regulation of genes involved in the labor process.
21561435 Cholesterol induced both a changed orientation and a decreased distance of the receptor-bound ligands, suggesting a more compact receptor state in association with cholesterol.
21208749 Girls homozygous for the G allele were characterized by smaller volumes of both left and right amygdala than were carriers of the A allele.
21090345 Significant differences in the content of OT and expression of OTR between fertile and infertile men suggested an association of OT with male infertility.
20926803 The increased ability of human amnion to produce prostaglandins in response to OXT treatment suggests a complementary role for the OXT/OXTR system in the activation of human amnion and the onset of labor.
20832055 The rs2254298A allele of OXTR was significantly associated with larger bilateral amygdala volume and larger the number of rs2254298A alleles an individual had, the larger their amygdala volume.
20832055 Observational study of gene-disease association. (HuGE Navigator)
20724662 findings suggest that OXTR rs53576 is sensitive to input from the social environment, specifically cultural norms regarding emotional social support seeking
20724662 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20711752 Significantly different oxytocin baseline concentrations and oxytocin receptor expressions between fertile and infertile men strongly suggest that oxytocin/oxytocin receptor system is likely to be linked with male infertility
20708845 The potential importance of this OXTR gene polymorphism in the etiology of depression and anxiety disorders.
20708845 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20670427 Inflammatory cytokines modulate the expression of functional oxytocin receptors in airway smooth muscle.
20647384 present multimodal imaging data implicating OXTR in hypothalamic-limbic circuits critical for emotion regulation and sociality in humans.
20585395 Observational study of gene-disease association. (HuGE Navigator)
20547038 Observational study of gene-disease association. (HuGE Navigator)
20547007 Observational study of gene-disease association. (HuGE Navigator)
20488544 The findings suggest that an OXTR haplotype is associated with a discrete depressive temperament. Clarification of the biological basis of this temperamental trait may help to elucidate the pathophysiology of depressive disorder.
20488544 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20436377 Observational study of gene-disease association. (HuGE Navigator)
20413116 Possible roles of oxytocin receptor and vasopressin-1alpha receptor in the pathomechanism of dysperistalsis and dysmenorrhea in patients with adenomyosis uteri.
20400491 This is the first study to suggest effects of OXTR genotype on physiological reactivity to infant crying.
20400491 Observational study of gene-disease association. (HuGE Navigator)
20347913 Oxytocin receptor polymorphisms were associated with social cognitive impairments in attention deficit disorder with hyperactivity.
20347913 Observational study of gene-disease association. (HuGE Navigator)
20303388 Data presented here does not support the role of common genetic variation in OXTR in the aetiology of autism spectrum disorders in Caucasian samples
20303388 Observational study of gene-disease association. (HuGE Navigator)
20196918 The variants in the OXTR were nominally associated with severity of overall symptoms accessed using the Brief Psychiatric Rating Scale (rs237885, rs237887) as well as on the improvement of the positive symptoms (rs11706648, rs4686301, rs237899).
20196918 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20097922 Immunoreactive OTR was found in the corpus luteum and granulosa cells of large and, surprisingly, also small pre-antral follicles of the ovary.
20096818 OTR and TRPV1 may be involved in dysmenorrhea and its severity in adenomyosis
20094064 OXTR has a significant role in conferring the risk of autism spectrum disorder in the Japanese population.
20094064 Observational study of gene-disease association. (HuGE Navigator)
19943975 Observational study of gene-disease association. (HuGE Navigator)
19934046 a naturally occurring genetic variation of the oxytocin receptor relates to both empathy and stress profiles
19934046 Observational study of gene-disease association. (HuGE Navigator)
19845972 These data provide further evidence for the role of OXTR and the oxytocin signaling pathway in the etiology of autism and, for the first time, implicate the epigenetic regulation of OXTR in the development of the disorder.
19777562 genetic variation in the OXTR gene might be relevant in the etiology of autism on high-functioning level
19777562 Observational study of gene-disease association. (HuGE Navigator)
19598235 Observational study of gene-disease association. (HuGE Navigator)
19515497 A significant novel association of the SNPs 6930G>A and 9073G>A within the OXTR gene with unipolar depressive disorder was found.
19515497 Observational study of gene-disease association. (HuGE Navigator)
19461999 The gene encoding the related oxytocin receptor (OXTR) was tested for association with the Dictator Game and a related paradigm, the Social Values Orientation (SVO) task.
19423652 oxytocin receptor responsiveness is regulated by G protein-coupled receptor kinase 6 in human myometrial smooth muscle
19376182 A role is supported for oxytocin receptor haplotypes in the generation of affectivity, emotional loneliness and intelligence quotient.
19376182 Observational study of gene-disease association. (HuGE Navigator)
19347709 Oxytocin, its receptor and the PGF(2alpha) receptor are involved in the regulation of labour through a paracrine mechanism.
19336370 Observational study of gene-disease association. (HuGE Navigator)
19126785 OTRs are capable of very efficient and complete resensitization due to receptor recycling via the rab4/rab5 short cycle
19086053 Observational study of gene-disease association. (HuGE Navigator)
19015103 Controlling for maternal education, depression and marital discord, OXTR genes were significantly associated with maternal sensitivity. Mothers with OXTR AA or AG genotypes were less sensitive than mothers with the GG genotype.
19015103 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19001515 Melatonin synergizes with oxytocin to promote myometrial cell contractions in vitro, which in vivo would promote coordinated and forceful contractions of the late term pregnant uterus necessary for parturition.
18312604 Androgen dependent prostate growth in benign prostate hyperplasia may be linked to the interaction of androgen binding protein and oxytocin receptor, associated with caveolin 1
18207134 The resulting pattern of findings confirmed the hypotheses of the significance of the genes involved in the development of affiliative behaviors in the manifestation of ASD, the strongest results were obtained for allelic associations with the OXTR genes.
18207134 Observational study of gene-disease association. (HuGE Navigator)
18082926 A lower oxytocin receptor gene expression at mid-cycle could be involved in the aetiology of primary dysmenorrhoea.
17952758 OTR staining occurred in most of these cells in myomas, while controls contained only scattered cells positive for OTR
17939166 Observational study of gene-disease association. (HuGE Navigator)
17939166 study is the first to report associations between AVPR1A and OXTR genetic variation with life history traits in humans
17893705 This study showing that SNPs and haplotypes in the OXTR gene confer risk for ASD.
17893705 Observational study of gene-disease association. (HuGE Navigator)
17728669 Observational study of gene-disease association. (HuGE Navigator)
17726073 Melatonin, like oxytocin, can negatively regulate oxytocin receptor transcription in human myometrial cells via modulation of protein kinase C signaling
17492653 Changes in prostatic concentrations of oxytocin (OT) that occur with aging and malignant disease may act to facilitate cell proliferation. Localization of oxytocin receptor within the plasma membrane modulates OT's proliferative response in the prostate.
17383819 Observational study of gene-disease association. (HuGE Navigator)
17383819 These findings provide support for association of OXTR with autism in a Caucasian population.
17148753 Specific amino acids in the RVSSVKL segment in the COOH-terminal region of the third intracellular domain of oxytocin receptor influence the ability of OTR to activate G protein-mediated actions.
16966388 increasing cell cholesterol levels is not sufficient per se to affect OTR signaling
16888077 results suggest elevation of IL1 in myometrium at the end of pregnancy initiates process of down-regulation of oxytocin receptors in advanced labour resulting in desensitization of the myometrium to elevated levels of oxytocin in blood during lactation
16333859 molecular dynamics analysis of mechanism of desmopressin binding in vasopressin V2 receptor versus vasopressin V1a and oxytocin receptors
16042376 The oxytocin receptor DRY motif, besides playing a crucial role in receptor activation, may also be implicated in receptor promiscuity
15992526 Observational study of gene-disease association. (HuGE Navigator)
15831296 Oxytocin receptor is expressed in smooth muscle cells and epithelial cells of peritoneal endometriotic lesions and ovarian endometriotic cysts
15705593 atosiban acts as a "biased agonist" of the human oxytocin receptors
15591449 Oxytocin receptor is highly expressed in the penis during fetal life and modulates migration and proliferation of its smooth muscle cells.
15093695 OT and OT-receptor mRNAs are expressed throughout the GI tract
15089977 the human oxytocin receptor forms dimeric and oligomeric complexes in vivo in intact living cells, and that these complexes exist at the cell surface level.
15089975 the oxytocin receptor localization in lipid rafts enriched in caveolin-1 turns the inhibition of cell growth into a proliferative response, eliciting different epidermal growth factor receptor/mitogen-activated protein kinase activation patterns.
15044599 Data demonstrate that the dynamics of oxytocin receptor expression can be modulated by stimulation with estradiol and oxytocin in both the pregnant and non-pregnant uterus.
15035619 Three amino acids in the hydrophilic face of helix 8 of OTR are important to its role in preserving the receptor conformation that is necessary for ligand binding and stimulation of G-protein-mediated phospholipase C activation.
14749664 Oxytocin receptor antagonist reduced peak tension to 43%+/-12% of its original value without affecting peak calcium.
14691010 Oxytocin receptor is expressed in penis ata concentration similar to that present in other portions of male genital tract and mediates corpus cavernosum contractility.
14664707 Oxytocin receptor forms homodimers and oligomers in the cell model used and that these oligomers are present at the cell surface.
12955084 depending on their localization, oxytocin receptors transactivate EGFR and activate ERK1/2 using different signalling intermediates. The final outcome is a different temporal pattern of EGFR and ERK1/2 phosphorylation
12843193 Oxytocin receptor is spatially regulated, with significantly greater expression in the fundal region of the uterus at term
12810550 oxytocin receptor activation of a Gbetagamma-mediated pathway as a consequence of Galpha(q) activation in myometrium and OTR-COSM6 cells that results in increased ERK1/2-P.
12270111 expressed in osteoclast cell cultures
12166628 estradiol and progesterone not only regulate oxytocin receptor expression and binding in normal mammary myoepithelium but also in malignant mammary cell lines
12161007 identification, localization and functional activity of oxytocin receptors in epididymis
12126740 oxytocin receptors are present on human osteoblast-like cells; when oxytocin binds, it decreases IL-6 production, which may affect bone metabolism in humans
11955056 The role of the N-terminus of the oxytocin receptor in high-affinity agonist binding has been characterized in detail, revealing that a single residue, Arg34, provides the agonist-specific epitope within this domain.
11140838 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MEGALAANWSAEAANASAAPPGAEGNRTAGPPRRNEALARVEVAVLCLILLLALSGNACVLLALRTTRQK      1 - 70
HSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQVVGMFASTYLLLLMSLDRCLA     71 - 140
ICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREVADGVFDCWAVFIQPWGPKAYITWITLAVYI    141 - 210
VPVIVLAACYGLISFKIWQNLRLKTAAAAAAEAPEGAAAGDGGRVALARVSSVKLISKAKIRTVKMTFII    211 - 280
VLAFIVCWTPFFFVQMWSVWDANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSAS    281 - 350
YLKGRRLGETSASKKSNSSSFVLSHRSSSQRSCSQPSTA                                   351 - 389
//

Text Mined References (211)

PMID Year Title
27015428 2016 The Idea Is Good, but…: Failure to Replicate Associations of Oxytocinergic Polymorphisms with Face-Inversion in the N170.
26903639 2016 Delay discounting, genetic sensitivity, and leukocyte telomere length.
26738630 2016 Polymorphisms of two loci at the oxytocin receptor gene in populations of Africa, Asia and South Europe.
26599592 2015 Lack of Association between Oxytocin Receptor (OXTR) Gene Polymorphisms and Alexithymia: Evidence from Patients with Obsessive-Compulsive Disorder.
26506050 2015 Genetic modulation of oxytocin sensitivity: a pharmacogenetic approach.
26488131 2016 Attachment style and oxytocin receptor gene variation interact in influencing social anxiety.
26477647 2015 Amygdala responses to salient social cues vary with oxytocin receptor genotype in youth.
26444016 2015 Polymorphism of the Oxytocin Receptor Gene Modulates Behavioral and Attitudinal Trust among Men but Not Women.
26406593 2015 Polymorphisms in Genes of Relevance for Oestrogen and Oxytocin Pathways and Risk of Barrett's Oesophagus and Oesophageal Adenocarcinoma: A Pooled Analysis from the BEACON Consortium.
26389606 2015 Genetic moderation of stability in attachment security from early childhood to age 18 years: A replication study.
26365303 2015 Genetic variation in the oxytocin receptor gene is associated with a social phenotype in autism spectrum disorders.
26241486 2015 Common oxytocin receptor gene variant interacts with rejection sensitivity to influence cortisol reactivity during negative evaluation.
26228411 2015 Examining gene-environment interactions in comorbid depressive and disruptive behavior disorders using a Bayesian approach.
26178189 2015 A common oxytocin receptor gene (OXTR) polymorphism modulates intranasal oxytocin effects on the neural response to social cooperation in humans.
26121678 2015 Association of Oxytocin Receptor Gene (OXTR) rs53576 Polymorphism with Sociality: A Meta-Analysis.
26110343 2015 Genetic association of the oxytocin receptor genes with panic, major depressive disorder, and social anxiety disorder.
26106053 2015 Severity of eating disorder symptoms related to oxytocin receptor polymorphisms in anorexia nervosa.
26061800 2015 Childhood maternal care is associated with DNA methylation of the genes for brain-derived neurotrophic factor (BDNF) and oxytocin receptor (OXTR) in peripheral blood cells in adult men and women.
25977357 2015 Gene-environment interaction between the oxytocin receptor (OXTR) gene and parenting behaviour on children's theory of mind.
25968600 2015 Signatures of positive selection in the cis-regulatory sequences of the human oxytocin receptor (OXTR) and arginine vasopressin receptor 1a (AVPR1A) genes.
25935637 2015 The association between 2D:4D ratio and cognitive empathy is contingent on a common polymorphism in the oxytocin receptor gene (OXTR rs53576).
25890851 2015 Methylation of the oxytocin receptor gene in clinically depressed patients compared to controls: The role of OXTR rs53576 genotype.
25773927 2015 Association between the oxytocin receptor gene polymorphism (rs53576) and bulimia nervosa.
25687563 2015 Fetal DNA methylation of autism spectrum disorders candidate genes: association with spontaneous preterm birth.
25680993 2015 Interaction between oxytocin receptor polymorphism and interdependent culture values on human empathy.
25675509 2015 Epigenetic modification of the oxytocin receptor gene influences the perception of anger and fear in the human brain.
25646574 2015 The oxytocin receptor gene and social perception.
25640833 2015 Religion priming and an oxytocin receptor gene (OXTR) polymorphism interact to affect self-control in a social context.
25637390 2015 Oxytocin receptor gene and racial ingroup bias in empathy-related brain activity.
25627343 2015 Expression of oxytocin receptors in the uterine junctional zone in women with adenomyosis.
25622005 2016 Sensitivity in detecting facial displays of emotion: Impact of maternal depression and oxytocin receptor genotype.
25593022 2015 Oxytocin expression and function in the posterior retina: a novel signaling pathway.
25564674 2015 Distress of ostracism: oxytocin receptor gene polymorphism confers sensitivity to social exclusion.
25563749 2015 Oxytocin receptor gene methylation: converging multilevel evidence for a role in social anxiety.
25476609 2015 Oxytocin receptor and vasopressin receptor 1a genes are respectively associated with emotional and cognitive empathy.
25419912 2015 A constructive replication of the association between the oxytocin receptor genotype and parenting.
25326040 2015 OXTR polymorphism predicts social relationships through its effects on social temperament.
25309987 2014 Clock gene modulates roles of OXTR and AVPR1b genes in prosociality.
25262417 2014 Variation in the oxytocin receptor gene is associated with increased risk for anxiety, stress and depression in individuals with a history of exposure to early life stress.
25244972 2014 Associations between oxytocin receptor genotypes and social cognitive performance in individuals with schizophrenia.
25199917 2014 Environmental risk, Oxytocin Receptor Gene (OXTR) methylation and youth callous-unemotional traits: a 13-year longitudinal study.
25092245 2015 The oxytocin receptor gene (OXTR) is associated with autism spectrum disorder: a meta-analysis.
25047302 2014 Moderation of maltreatment effects on childhood borderline personality symptoms by gender and oxytocin receptor and FK506 binding protein 5 genes.
25003328 2015 Social stress and the oxytocin receptor gene interact to predict antisocial behavior in an at-risk cohort.
25001970 2014 Oxytocin receptor gene rs53576 polymorphism modulates oxytocin-dopamine interaction and neuroticism traits--a SPECT study.
24916666 2014 Association between the oxytocin receptor (OXTR) gene and children's social cognition at 18 months.
24836510 2015 Resequencing and association analysis of OXTR with autism spectrum disorder in a Japanese population.
24814480 2014 Social cognition, face processing, and oxytocin receptor single nucleotide polymorphisms in typically developing children.
24749639 2014 Motherhood and oxytocin receptor genetic variation are associated with selective changes in electrocortical responses to infant facial expressions.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24703166 2014 Oxytocin receptor gene polymorphism (rs53576) moderates the intergenerational transmission of depression.
24660771 2014 Oxytocin and vasopressin receptor polymorphisms interact with circulating neuropeptides to predict human emotional reactions to stress.
24621820 2014 Personality, behavior and environmental features associated with OXTR genetic variants in British mothers.
24618689 2014 Affiliation buffers stress: cumulative genetic risk in oxytocin-vasopressin genes combines with early caregiving to predict PTSD in war-exposed young children.
24523928 2014 Differential methylation of the oxytocin receptor gene in patients with anorexia nervosa: a pilot study.
24458227 2014 An attempt to identify single nucleotide polymorphisms contributing to possible relationships between personality traits and oxytocin-related genes.
24454713 2014 Oxytocin receptor gene polymorphisms are associated with human directed social behavior in dogs (Canis familiaris).
24393355 2014 Possible association between the oxytocin receptor gene and N-acetylaspartate of the right medial temporal lobe in autism spectrum disorders.
24367110 2014 Common polymorphism in the oxytocin receptor gene (OXTR) is associated with human social recognition skills.
24295535 2014 Oxytocin receptor gene variation predicts empathic concern and autonomic arousal while perceiving harm to others.
24223720 2013 The oxytocin receptor gene (OXTR) in relation to state levels of loneliness in adolescence: evidence for micro-level gene-environment interactions.
24209975 2014 Are genetic variations in OXTR, AVPR1A, and CD38 genes important to social integration? Results from two large U.S. cohorts.
24128365 2013 Relationship between oxytocin receptor genotype and recognition of facial emotion.
24120094 2014 Oxytocin receptor genotype modulates ventral striatal activity to social cues and response to stressful life events.
24059750 2014 Polymorphisms in the oxytocin receptor gene are associated with the development of psychopathy.
23974948 2014 Cumulative risk on the oxytocin receptor gene (OXTR) underpins empathic communication difficulties at the first stages of romantic love.
23946005 2014 Neural correlate of autistic-like traits and a common allele in the oxytocin receptor gene.
23921259 2014 A sociability gene? Meta-analysis of oxytocin receptor genotype effects in humans.
23915847 2013 Molecular analysis of parturition via oxytocin receptor expression.
23889750 2013 Sequence variants in oxytocin pathway genes and preterm birth: a candidate gene association study.
23863476 2014 Oxytonergic circuitry sustains and enables creative cognition in humans.
23838880 2013 Oxytocin receptor gene (OXTR) in relation to loneliness in adolescence: interactions with sex, parental support, and DRD2 and 5-HTTLPR genotypes.
23731038 2013 Genetic contributions to continuity and change in attachment security: a prospective, longitudinal investigation from infancy to young adulthood.
23708061 2014 Neural mechanisms of oxytocin receptor gene mediating anxiety-related temperament.
23684879 2013 Variant in OXTR gene and functional connectivity of the hypothalamus in normal subjects.
23678036 2013 Effects of PGF2? on the expression of uterine activation proteins in pregnant human myometrial cells from upper and lower segment.
23653389 2013 The influence of maternal body mass index on myometrial oxytocin receptor expression in pregnancy.
23637833 2013 Interaction between oxytocin genotypes and early experience predicts quality of mothering and postpartum mood.
23562248 2013 The association between the oxytocin receptor gene (OXTR) and hypnotizability.
23547247 2014 Variation in oxytocin receptor gene (OXTR) polymorphisms is associated with emotional and behavioral reactions to betrayal.
23470776 2013 Environmental stress, oxytocin receptor gene (OXTR) polymorphism, and mental health following collective stress.
23355275 2013 Up-regulation of oxytocin receptor expression at term is related to maternal body mass index.
23354128 2013 Helping hands, healthy body? Oxytocin receptor gene and prosocial behavior interact to buffer the association between stress and physical health.
23284802 2012 Association between oxytocin receptor gene polymorphisms and self-rated 'empathic concern' in schizophrenia.
23252931 2012 Oxytocin receptor (OXTR) gene and risk of schizophrenia: case-control and family-based analyses and meta-analysis in a Japanese population.
23219106 2013 Association between OXTR and clinical phenotypes of autism spectrum disorders.
23089921 2013 Common oxytocin receptor gene polymorphisms and the risk for preterm birth.
23040540 2013 Oxytocin, stress and social behavior: neurogenetics of the human oxytocin system.
22999795 2013 Dysmenorrhea and its severity are associated with increased uterine contractility and overexpression of oxytocin receptor (OTR) in women with symptomatic adenomyosis.
22986294 2013 Function and structure in social brain regions can link oxytocin-receptor genes with autistic social behavior.
22892716 2012 Dynamic changes in DNA methylation of stress-associated genes (OXTR, BDNF?) after acute psychosocial stress.
22882465 2012 Are single nucleotide polymorphisms in the oxytocin and vasopressin 1A/1B receptor genes likely candidates for variation in ejaculatory function?
22809402 2013 Associations between the oxytocin receptor gene (OXTR) and "mind-reading" in humans--an exploratory study.
22763666 2012 The influence of oxytocin administration on responses to infant faces and potential moderation by OXTR genotype.
22651577 2013 Oxytocin and oxytocin receptor gene polymorphisms and risk for schizophrenia: a case-control study.
22563705 2012 Differential susceptibility in spillover between interparental conflict and maternal parenting practices: evidence for OXTR and 5-HTT genes.
22510359 2012 Does the oxytocin receptor (OXTR) polymorphism (rs2254298) confer 'vulnerability' for psychopathology or 'differential susceptibility'? Insights from evolution.
22487732 2012 Influence of COX-2 and OXTR polymorphisms on treatment outcome in treatment resistant depression.
22457427 2012 The neurogenetics of nice: receptor genes for oxytocin and vasopressin interact with threat to predict prosocial behavior.
22421562 2012 Associations between oxytocin receptor gene (OXTR) polymorphisms and self-reported aggressive behavior and anger: Interactions with alcohol consumption.
22372486 2012 The role of oxytocin and oxytocin receptor gene variants in childhood-onset aggression.
22357335 2012 The association between oxytocin receptor gene polymorphism (OXTR) and trait empathy.
22336563 2012 Sensitive parenting is associated with plasma oxytocin and polymorphisms in the OXTR and CD38 genes.
22296985 2012 Ignorance is no excuse: moral judgments are influenced by a genetic variation on the oxytocin receptor gene.
22294460 2012 Childhood aggression, callous-unemotional traits and oxytocin genes.
22212599 2012 Oxytocin receptor (OXTR) is not associated with optimism in the Nurses' Health Study.
22146101 2012 Variation in the oxytocin receptor gene influences neurocardiac reactivity to social stress and HPA function: a population based study.
22123970 2011 Common oxytocin receptor gene (OXTR) polymorphism and social support interact to reduce stress in humans.
22084107 2011 Thin-slicing study of the oxytocin receptor (OXTR) gene and the evaluation and expression of the prosocial disposition.
22064162 2012 Genome-wide association study of comorbid depressive syndrome and alcohol dependence.
22015110 2012 Variation in the oxytocin receptor gene is associated with pair-bonding and social behavior.
21984889 2011 Oxytocin and social motivation.
21964067 2012 Functional interactions between the oxytocin receptor and the ?2-adrenergic receptor: implications for ERK1/2 activation in human myometrial cells.
21963428 2012 Allosteric interactions between the oxytocin receptor and the ?2-adrenergic receptor in the modulation of ERK1/2 activation are mediated by heterodimerization.
21934640 2012 Test of association between 10 single nucleotide polymorphisms in the oxytocin receptor gene and conduct disorder.
21896752 2011 Oxytocin receptor gene (OXTR) is related to psychological resources.
21876222 2011 [Genetic variability of the oxytocine receptor: an in silico study].
21734268 2011 Synergistic regulation of human oxytocin receptor promoter by CCAAT/ enhancer-binding protein and RELA.
21561435 2011 Cholesterol-induced conformational changes in the oxytocin receptor.
21208749 2011 Variant in oxytocin receptor gene is associated with amygdala volume.
21090345 2010 [Neuropeptide oxytocin and male infertility].
20926803 2011 Labor and inflammation increase the expression of oxytocin receptor in human amnion.
20832055 2010 Association between the oxytocin receptor gene and amygdalar volume in healthy adults.
20724662 2010 Culture, distress, and oxytocin receptor polymorphism (OXTR) interact to influence emotional support seeking.
20711752 2010 Association between neuropeptide oxytocin and male infertility.
20708845 2011 Oxytocin receptor gene polymorphism (rs2254298) interacts with familial risk for psychopathology to predict symptoms of depression and anxiety in adolescent girls.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20670427 2010 Expression and activation of the oxytocin receptor in airway smooth muscle cells: Regulation by TNFalpha and IL-13.
20647384 2010 A common allele in the oxytocin receptor gene (OXTR) impacts prosocial temperament and human hypothalamic-limbic structure and function.
20585395 2010 No association between oxytocin receptor (OXTR) gene polymorphisms and experimentally elicited social preferences.
20547038 2010 Variants in the oxytocin gene and risk for schizophrenia.
20547007 2010 No association between oxytocin or prolactin gene variants and childhood-onset mood disorders.
20488544 2010 The association between oxytocin receptor gene (OXTR) polymorphisms and affective temperaments, as measured by TEMPS-A.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20436377 2010 Polymorphisms of candidate genes in Slovak autistic patients.
20413116 2010 Possible roles of oxytocin receptor and vasopressin-1? receptor in the pathomechanism of dysperistalsis and dysmenorrhea in patients with adenomyosis uteri.
20400491 2011 Oxytocin receptor gene and depressive symptoms associated with physiological reactivity to infant crying.
20347913 2010 Evidence that genetic variation in the oxytocin receptor (OXTR) gene influences social cognition in ADHD.
20303388 2010 Oxytocin receptor (OXTR) does not play a major role in the aetiology of autism: genetic and molecular studies.
20196918 2010 Schizophrenia severity and clozapine treatment outcome association with oxytocinergic genes.
20097922 2010 Oxytocin receptors in the primate ovary: molecular identity and link to apoptosis in human granulosa cells.
20096818 2010 Immunoreactivity of oxytocin receptor and transient receptor potential vanilloid type 1 and its correlation with dysmenorrhea in adenomyosis.
20094064 2010 Association of the oxytocin receptor (OXTR) gene polymorphisms with autism spectrum disorder (ASD) in the Japanese population.
19943975 2009 Polymorphism in the oxytocin promoter region in patients with lactase non-persistence is not related to symptoms.
19934046 2009 Oxytocin receptor genetic variation relates to empathy and stress reactivity in humans.
19845972 2009 Genomic and epigenetic evidence for oxytocin receptor deficiency in autism.
19777562 2010 Evidence for the involvement of genetic variation in the oxytocin receptor gene (OXTR) in the etiology of autistic disorders on high-functioning level.
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
19515497 2009 Oxytocin receptor polymorphisms and adult attachment style in patients with depression.
19461999 2009 The oxytocin receptor (OXTR) contributes to prosocial fund allocations in the dictator game and the social value orientations task.
19423652 2009 Regulation of oxytocin receptor responsiveness by G protein-coupled receptor kinase 6 in human myometrial smooth muscle.
19376182 2009 Associations between the oxytocin receptor gene (OXTR) and affect, loneliness and intelligence in normal subjects.
19347709 2009 Myometrial oxytocin receptor mRNA concentrations at preterm and term delivery - the influence of external oxytocin.
19336370 2009 Determination of genetic predisposition to patent ductus arteriosus in preterm infants.
19126785 2009 Intracellular trafficking of the human oxytocin receptor: evidence of receptor recycling via a Rab4/Rab5 "short cycle".
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19015103 2008 Oxytocin receptor (OXTR) and serotonin transporter (5-HTT) genes associated with observed parenting.
19001515 2009 Melatonin synergizes with oxytocin to enhance contractility of human myometrial smooth muscle cells.
18312604 2008 Colocalization of androgen binding protein, oxytocin receptor, caveolin 1 and proliferation marker p21 in benign prostate hyperplasia.
18207134 2008 Genes controlling affiliative behavior as candidate genes for autism.
18082926 2008 Endometrial expression of vasopressin, oxytocin and their receptors in patients with primary dysmenorrhoea and healthy volunteers at ovulation.
17952758 2008 Expression of sex hormone-binding globulin, oxytocin receptor, caveolin-1 and p21 in leiomyoma.
17939166 2007 AVPR1A and OXTR polymorphisms are associated with sexual and reproductive behavioral phenotypes in humans. Mutation in brief no. 981. Online.
17893705 2008 Association between the oxytocin receptor (OXTR) gene and autism: relationship to Vineland Adaptive Behavior Scales and cognition.
17728669 2007 Association analysis of 15 polymorphisms within 10 candidate genes for antisocial behavioural traits.
17726073 2007 Transcriptional inhibition of oxytocin receptor expression in human myometrial cells by melatonin involves protein kinase C signaling.
17492653 2007 The effect of oxytocin on cell proliferation in the human prostate is modulated by gonadal steroids: implications for benign prostatic hyperplasia and carcinoma of the prostate.
17383819 2007 Association of the oxytocin receptor gene (OXTR) in Caucasian children and adolescents with autism.
17148753 2007 Amino acids in the COOH-terminal region of the oxytocin receptor third intracellular domain are important for receptor function.
16966388 2006 Effects of cholesterol manipulation on the signaling of the human oxytocin receptor.
16888077 2006 Interleukin-1-induced NF-kappaB recruitment to the oxytocin receptor gene inhibits RNA polymerase II-promoter interactions in cultured human myometrial cells.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16333859 2006 Investigation of mechanism of desmopressin binding in vasopressin V2 receptor versus vasopressin V1a and oxytocin receptors: molecular dynamics simulation of the agonist-bound state in the membrane-aqueous system.
16042376 2005 The DRY motif as a molecular switch of the human oxytocin receptor.
15992526 2005 Positive association of the oxytocin receptor gene (OXTR) with autism in the Chinese Han population.
15831296 2005 Oxytocin receptor expression in smooth muscle cells of peritoneal endometriotic lesions and ovarian endometriotic cysts.
15705593 2005 The oxytocin receptor antagonist atosiban inhibits cell growth via a "biased agonist" mechanism.
15591449 2005 Identification, characterization and biological activity of oxytocin receptor in the developing human penis.
15093695 2004 Oxytocin and oxytocin-receptor mRNA expression in the human gastrointestinal tract: a polymerase chain reaction study.
15089977 2004 Homo- and hetero-dimeric complex formations of the human oxytocin receptor.
15089975 2004 Oxytocin and oxytocin receptors in cancer cells and proliferation.
15044599 2004 Oxytocin receptor gene expression of estrogen-stimulated human myometrium in extracorporeally perfused non-pregnant uteri.
15035619 2004 Residues in the hydrophilic face of putative helix 8 of oxytocin receptor are important for receptor function.
14749664 2004 Effect of an oxytocin receptor antagonist and rho kinase inhibitor on the [Ca++]i sensitivity of human myometrium.
14691010 2004 Oxytocin receptor is expressed in the penis and mediates an estrogen-dependent smooth muscle contractility.
14664707 2003 Identification of dimeric and oligomeric complexes of the human oxytocin receptor by co-immunoprecipitation and bioluminescence resonance energy transfer.
12955084 2003 Oxytocin receptor elicits different EGFR/MAPK activation patterns depending on its localization in caveolin-1 enriched domains.
12843193 2003 Paracrine oxytocin and estradiol demonstrate a spatial increase in human intrauterine tissues with labor.
12810550 2003 Extracellular signal-regulated kinase 1/2 activation by myometrial oxytocin receptor involves Galpha(q)Gbetagamma and epidermal growth factor receptor tyrosine kinase activation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12270111 2002 Human osteoclasts express oxytocin receptor.
12166628 2002 Estradiol and progesterone regulate oxytocin receptor binding and expression in human breast cancer cell lines.
12161007 2002 Identification, localization and functional activity of oxytocin receptors in epididymis.
12126740 2002 Oxytocin stimulates proliferation of human osteoblast-like cells.
11955056 2002 Agonist-specific, high-affinity binding epitopes are contributed by an arginine in the N-terminus of the human oxytocin receptor.
11279203 2001 Molecular determinants underlying the formation of stable intracellular G protein-coupled receptor-beta-arrestin complexes after receptor endocytosis*.
11140838 2000 A multivariate analysis of 59 candidate genes in personality traits: the temperament and character inventory.
10910058 2000 A plasmin-derived hexapeptide from the carboxyl end of osteocalcin counteracts oxytocin-mediated growth inhibition [corrected] of osteosarcoma cells.
10858434 2000 Dynamic interaction of human vasopressin/oxytocin receptor subtypes with G protein-coupled receptor kinases and protein kinase C after agonist stimulation.
10698266 1999 Molecular modeling of the oxytocin receptor/bioligand interactions.
10453463 1999 The oxytocin receptor.
10027615 Regulation of the human oxytocin receptor in the uterus: a molecular approach.
9433921 1997 The role of N-terminal glycosylation in the human oxytocin receptor.
9283088 1997 Cholesterol as modulator of receptor function.
8593830 1996 Expression of oxytocin receptor in human pregnant myometrium.
8593829 1996 Investigation of the oxytocin receptor expression in human breast cancer tissue using newly established monoclonal antibodies.
8077313 1993 Effect of oxytocin on free intracellular Ca2+ levels and progesterone release by human granulosa-lutein cells.
7921229 1994 Histamine- and stress-induced prolactin secretion: importance of vasopressin V1- and V2-receptors.
7798245 1994 Structural organization of the human oxytocin receptor gene.
7607693 1995 The oxytocin receptor gene (OXTR) localizes to human chromosome 3p25 by fluorescence in situ hybridization and PCR analysis of somatic cell hybrids.
1313946 1992 Structure and expression of a human oxytocin receptor.