Property Summary

NCBI Gene PubMed Count 132
PubMed Score 15349.64
PubTator Score 2344.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6514 2.2e-08
osteosarcoma 7766 1.7e-03

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.113 1.7e-03
psoriasis -1.300 2.2e-08

Protein-protein Interaction (6)

Gene RIF (112)

AA Sequence

MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTA      1 - 70
EALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR                    71 - 125
//

Text Mined References (133)

PMID Year Title