Property Summary

NCBI Gene PubMed Count 30
PubMed Score 9.38
PubTator Score 7.35

Knowledge Summary

Patent (3,270)

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -2.400 5.4e-05
osteosarcoma -1.565 9.5e-06
intraductal papillary-mucinous neoplasm ... 2.200 8.5e-04
group 3 medulloblastoma 1.300 1.5e-03

Gene RIF (15)

PMID Text
24393035 the WNK-regulated SPAK/OSR1 kinases directly phosphorylate the N[K]CCs and KCCs, promoting their stimulation and inhibition respectively.
23034389 SPAK and OSR1, which are often coexpressed in cells, can form functional heterodimers.
22989884 Data show that intracellular association between WNK1 and oxidative stress-responsive 1 (OSR1) is required for stimulation of OSR1 and Na(+), K(+), Cl(-)-Cotransporter NKCC1 and NKCC2 activities by osmotic stress.
20889219 Observational study of gene-disease association. (HuGE Navigator)
20819979 OXSR1 and WNK3 transcripts were substantially overexpressed in subjects with schizophrenia relative to comparison subjects.
19177573 crystal structure of OSR1 kinase domain has been solved at 2.25 A; OSR1 forms a domain-swapped dimer in an inactive conformation, in which P+1 loop and alphaEF helix are swapped between dimer-related monomers
18831043 The first crystal structure of an OSR1 fragment encompassing the catalytic domain of the enzyme, is reported.
18270262 The WNK1-SPAK/OSR1 signalling pathway plays a key role in controlling the phosphorylation and activity of NCC.
17721439 These results provide the first molecular insight into the mechanism by which the SPAK and OSR1 kinases specifically recognize their upstream activators and downstream substrates.
16832045 OSR1 and sterile20-related, proline-, alanine-rich kinase are likely links between WNK lysine deficient protein kinase 1 and solute carrier family 12 in a pathway that contributes to volume regulation and blood pressure homeostasis in mammals
16669787 data establish that the CCT domain functions as a multipurpose docking site, enabling SPAK/OSR1 to interact with substrates (NKCC1) and activators (WNK1/WNK4)
16389068 OXSR1 kinase is shown to interact with the three RELT family members RELT, RELL1, and RELL2 by in vitro co-immunoprecipitation; additionally, OXSR1 phosphorylates RELT family members in an in vitro kinase assay.
16263722 WNK1 and SPAK/OSR1 mediate the hypotonic stress signaling pathway to cation-chloride-coupled cotransporters
14707132 isolation and characterization of OSR1 (oxidative stress-responsive 1), one of two human Fray homologs. OSR1 is a 58-kDa protein of 527 amino acids that is widely expressed in mammalian tissues and cell lines
12386165 interacts with cation chloride cotransporters

AA Sequence

MSEDSSALPWSINRDDYELQEVIGSGATAVVQAAYCAPKKEKVAIKRINLEKCQTSMDELLKEIQAMSQC      1 - 70
HHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHIVAKGEHKSGVLDESTIATILREVLEGLEYLHKN     71 - 140
GQIHRDVKAGNILLGEDGSVQIADFGVSAFLATGGDITRNKVRKTFVGTPCWMAPEVMEQVRGYDFKADI    141 - 210
WSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPSLETGVQDKEMLKKYGKSFRKMISLCLQKDPEKRP    211 - 280
TAAELLRHKFFQKAKNKEFLQEKTLQRAPTISERAKKVRRVPGSSGRLHKTEDGGWEWSDDEFDEESEEG    281 - 350
KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQA    351 - 420
LSSGSGSQETKIPISLVLRLRNSKKELNDIRFEFTPGRDTAEGVSQELISAGLVDGRDLVIVAANLQKIV    421 - 490
EEPQSNRSVTFKLASGVEGSDIPDDGKLIGFAQLSIS                                     491 - 527
//

Text Mined References (43)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24393035 2014 The WNK-regulated SPAK/OSR1 kinases directly phosphorylate and inhibit the K+-Cl- co-transporters.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23034389 2012 Calcium-binding protein 39 facilitates molecular interaction between Ste20p proline alanine-rich kinase and oxidative stress response 1 monomers.
22989884 2012 Interactions with WNK (with no lysine) family members regulate oxidative stress response 1 and ion co-transporter activity.
22361696 2012 Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21423148 2011 MO25 is a master regulator of SPAK/OSR1 and MST3/MST4/YSK1 protein kinases.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20889219 2012 STK39 is an independent risk factor for male hypertension in Han Chinese.
20819979 2011 Altered expression of regulators of the cortical chloride transporters NKCC1 and KCC2 in schizophrenia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19177573 2009 Crystal structure of domain-swapped STE20 OSR1 kinase domain.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18831043 2008 Structure of the OSR1 kinase, a hypertension drug target.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18270262 2008 Activation of the thiazide-sensitive Na+-Cl- cotransporter by the WNK-regulated kinases SPAK and OSR1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17721439 2007 Structural insights into the recognition of substrates and activators by the OSR1 kinase.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17452356 2007 Non-EST-based prediction of novel alternatively spliced cassette exons with cell signaling function in Caenorhabditis elegans and human.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16832045 2006 WNK1 and OSR1 regulate the Na+, K+, 2Cl- cotransporter in HeLa cells.
16669787 2006 Functional interactions of the SPAK/OSR1 kinases with their upstream activator WNK1 and downstream substrate NKCC1.
16389068 2006 Identification of RELT homologues that associate with RELT and are phosphorylated by OSR1.
16263722 2005 WNK1 regulates phosphorylation of cation-chloride-coupled cotransporters via the STE20-related kinases, SPAK and OSR1.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14707132 2004 Characterization of OSR1, a member of the mammalian Ste20p/germinal center kinase subfamily.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12386165 2002 Cation chloride cotransporters interact with the stress-related kinases Ste20-related proline-alanine-rich kinase (SPAK) and oxidative stress response 1 (OSR1).
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10231028 1999 Characterization of a 1200-kb genomic segment of chromosome 3p22-p21.3.
10083736 1999 Isolation and characterization of a novel serine threonine kinase gene on chromosome 3p22-21.3.