Property Summary

NCBI Gene PubMed Count 9
PubMed Score 65.08
PubTator Score 38.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 2.1e-04
lung cancer 4740 1.6e-03
pancreatic ductal adenocarcinoma liver metastasis 1962 9.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
tuberculosis 2010 3.96 2.0
Malaria 160 3.049 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.900 1.6e-03
ovarian cancer 1.500 2.1e-04
pancreatic ductal adenocarcinoma liver m... -1.362 9.9e-03

Gene RIF (2)

AA Sequence

MSNCLQNFLKITSTRLLCSRLCQQLRSKRKFFGTVPISRLHRRVVITGIGLVTPLGVGTHLVWDRLIGGE      1 - 70
SGIVSLVGEEYKSIPCSVAAYVPRGSDEGQFNEQNFVSKSDIKSMSSPTIMAIGAAELAMKDSGWHPQSE     71 - 140
ADQVATGVAIGMGMIPLEVVSETALNFQTKGYNKVSPFFVPKILVNMAAGQVSIRYKLKGPNHAVSTACT    141 - 210
TGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSLAGFSRARALSTNSDPKLACRPFHPKRDGFVMGEGA    211 - 280
AVLVLEEYEHAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQPEEISYINAHAT    281 - 350
STPLGDAAENKAIKHLFKDHAYALAVSSTKGATGHLLGAAGAVEAAFTTLACYYQKLPPTLNLDCSEPEF    351 - 420
DLNYVPLKAQEWKTEKRFIGLTNSFGFGGTNATLCIAGL                                   421 - 459
//

Text Mined References (14)

PMID Year Title