Property Summary

NCBI Gene PubMed Count 9
PubMed Score 65.08
PubTator Score 38.33

Knowledge Summary


No data available


  Disease (3)

Disease Target Count P-value
ovarian cancer 8297 2.1e-04
lung cancer 4607 1.6e-03
pancreatic ductal adenocarcinoma liver metastasis 1911 9.9e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
tuberculosis 1963 3.96 2.0
Malaria 155 3.049 1.5


  Differential Expression (3)

Disease log2 FC p
lung cancer 1.900 1.6e-03
ovarian cancer 1.500 2.1e-04
pancreatic ductal adenocarcinoma liver m... -1.362 9.9e-03

Gene RIF (2)

AA Sequence

DLNYVPLKAQEWKTEKRFIGLTNSFGFGGTNATLCIAGL                                   421 - 459

Text Mined References (14)

PMID Year Title