Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.50
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
sarcoidosis 370 6.1e-06
osteosarcoma 7950 5.7e-05
ependymoma 4679 3.5e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Skin squamous cell carcinoma 2 4.115 2.1
Basal cell carcinoma 54 3.153 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma -1.100 3.5e-03
osteosarcoma -1.644 5.7e-05
sarcoidosis -1.200 6.1e-06

Gene RIF (1)

AA Sequence

MACAAVMIPGLLRCSVGAIRIEAASLRLTLSTLRHLTLTSIMKSKRKTDHMERTASVLRREIVSAAKVCG      1 - 70
AASESPSVKSLRLLVADQDFSFKAGQWVDFFIPGVSVVGGFSICSSPRLLEQERVIELAVKYTNHPPALW     71 - 140
VHNTCTLDCEVAVRVGGEFFFDPQPADASRNLVLIAGGVGINPLLSILRHAADLLREQANKRNGYEIGTI    141 - 210
KLFYSAKNTSELLFKKNILDLVNEFPEKIACSLHVTKQTTQINAELKPYITEGRITEKEIRDHISKETLF    211 - 280
YICGPPPMTDFFSKQLENNHVPKEHICFEKWW                                          281 - 312
//

Text Mined References (6)

PMID Year Title