Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.50
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
sarcoidosis 368 6.1e-06
osteosarcoma 7933 5.7e-05
ependymoma 2514 3.5e-03
Disease Target Count Z-score Confidence
Skin squamous cell carcinoma 3 4.098 2.0
Basal cell carcinoma 31 3.143 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma -1.100 3.5e-03
osteosarcoma -1.644 5.7e-05
sarcoidosis -1.200 6.1e-06

Synonym

Accession Q96HP4 Q2HYC7 Q59FA4
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MACAAVMIPGLLRCSVGAIRIEAASLRLTLSTLRHLTLTSIMKSKRKTDHMERTASVLRREIVSAAKVCG      1 - 70
AASESPSVKSLRLLVADQDFSFKAGQWVDFFIPGVSVVGGFSICSSPRLLEQERVIELAVKYTNHPPALW     71 - 140
VHNTCTLDCEVAVRVGGEFFFDPQPADASRNLVLIAGGVGINPLLSILRHAADLLREQANKRNGYEIGTI    141 - 210
KLFYSAKNTSELLFKKNILDLVNEFPEKIACSLHVTKQTTQINAELKPYITEGRITEKEIRDHISKETLF    211 - 280
YICGPPPMTDFFSKQLENNHVPKEHICFEKWW                                          281 - 312
//

Text Mined References (6)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.