Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.6e-04
osteosarcoma 7950 3.3e-04
ovarian cancer 8520 4.2e-04

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.073 3.3e-04
ovarian cancer 1.100 4.2e-04
psoriasis 1.400 2.6e-04

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MLLRRVVEGGRAVAAAVRGSGARRFSSPDCCQRLPGGGSFLQRHHPGAQAPDGRRKFGTDHVEVGSQAGA      1 - 70
DGTRPPKASLPPELQPPTNCCMSGCPNCVWVEYADRLLQHFQDGGERALAALEEHVADENLKAFLRMEIR     71 - 140
LHTRCGG                                                                   141 - 147
//

Text Mined References (6)

PMID Year Title