Property Summary

NCBI Gene PubMed Count 15
PubMed Score 21.32
PubTator Score 16.37

Knowledge Summary

Patent (3,260)

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 3.7e-19

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 3.7e-19

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19760608 Down-Regulation of OXGR1 through DNA Methylation is associated with hepatocellular carcinoma.
15001573 P2Y15 is a cell surface receptor for AMP and adenosine

AA Sequence

MNEPLDYLANASDFPDYAAAFGNCTDENIPLKMHYLPVIYGIIFLVGFPGNAVVISTYIFKMRPWKSSTI      1 - 70
IMLNLACTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFSFHFNLYSSILFLTCFSIFRYCVIIHPMS     71 - 140
CFSIHKTRCAVVACAVVWIISLVAVIPMTFLITSTNRTNRSACLDLTSSDELNTIKWYNLILTATTFCLP    141 - 210
LVIVTLCYTTIIHTLTHGLQTDSCLKQKARRLTILLLLAFYVCFLPFHILRVIRIESRLLSISCSIENQI    211 - 280
HEAYIVSRPLAALNTFGNLLLYVVVSDNFQQAVCSTVRCKVSGNLEQAKKISYSNNP                 281 - 337
//

Text Mined References (15)

PMID Year Title
27324180 2016 Expression and localization of GPR99 in human nasal mucosa.
23200873 2013 A novel model of spontaneous otitis media with effusion (OME) in the Oxgr1 knock-out mouse.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19760608 2009 Aberrant DNA methylation profile and frequent methylation of KLK10 and OXGR1 genes in hepatocellular carcinoma.
18404396 2004 The fate of P2Y-related orphan receptors: GPR80/99 and GPR91 are receptors of dicarboxylic acids.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15629198 2005 The recently deorphanized GPR80 (GPR99) proposed to be the P2Y15 receptor is not a genuine P2Y receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15141213 2004 Citric acid cycle intermediates as ligands for orphan G-protein-coupled receptors.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
15001573 2004 Identification and characterization of a cell-surface receptor, P2Y15, for AMP and adenosine.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12098360 2002 GPR99, a new G protein-coupled receptor with homology to a new subgroup of nucleotide receptors.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.
11574155 2001 Discovery and mapping of ten novel G protein-coupled receptor genes.