Property Summary

Ligand Count 1
NCBI Gene PubMed Count 15
PubMed Score 22.35
PubTator Score 16.37

Knowledge Summary

Patent (3,260)

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.7e-19
Disease Target Count Z-score Confidence
Griscelli syndrome type 2 12 3.519 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 3.7e-19

Gene RIF (4)

AA Sequence

MNEPLDYLANASDFPDYAAAFGNCTDENIPLKMHYLPVIYGIIFLVGFPGNAVVISTYIFKMRPWKSSTI      1 - 70
IMLNLACTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFSFHFNLYSSILFLTCFSIFRYCVIIHPMS     71 - 140
CFSIHKTRCAVVACAVVWIISLVAVIPMTFLITSTNRTNRSACLDLTSSDELNTIKWYNLILTATTFCLP    141 - 210
LVIVTLCYTTIIHTLTHGLQTDSCLKQKARRLTILLLLAFYVCFLPFHILRVIRIESRLLSISCSIENQI    211 - 280
HEAYIVSRPLAALNTFGNLLLYVVVSDNFQQAVCSTVRCKVSGNLEQAKKISYSNNP                 281 - 337
//

Text Mined References (15)

PMID Year Title