Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.51
PubTator Score 5.28

Knowledge Summary

Patent (1,548)

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 1.8e-04

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.070 1.8e-04

Gene RIF (6)

PMID Text
25657046 membrane receptor OxeR1 is involved in StAR protein induction and activation of steroidogenesis triggered by cAMP or angiotensin II, acting, at least in part, through ERK1/2 activation.
24733850 Gue1654 as a non-Galphai-biased antagonist of OXE-R that provides a new basis for therapeutic intervention in inflammatory diseases that involve activation of eosinophils, neutrophils, and monocytes.
23643940 OXER1 has a role in regulating the survival-promoting effects of arachidonate 5-lipoxygenase in prostate cancer cells
16289380 5-oxoER is critical for prostate cancer cell survival.
12606753 identification and cloning of a novel GPCR, R527; 5-oxo-ETE was identified as the ligand for R527; very high level of mRNA expression in eosinophils with high expression also detected in neutrophils and lung macrophages
12065583 Identification of a novel human receptor coupled to G(i/o).

AA Sequence

MLCHRGGQLIVPIIPLCPEHSCRGRRLQNLLSGPWPKQPMELHNLSSPSPSLSSSVLPPSFSPSPSSAPS      1 - 70
AFTTVGGSSGGPCHPTSSSLVSAFLAPILALEFVLGLVGNSLALFIFCIHTRPWTSNTVFLVSLVAADFL     71 - 140
LISNLPLRVDYYLLHETWRFGAAACKVNLFMLSTNRTASVVFLTAIALNRYLKVVQPHHVLSRASVGAAA    141 - 210
RVAGGLWVGILLLNGHLLLSTFSGPSCLSYRVGTKPSASLRWHQALYLLEFFLPLALILFAIVSIGLTIR    211 - 280
NRGLGGQAGPQRAMRVLAMVVAVYTICFLPSIIFGMASMVAFWLSACRSLDLCTQLFHGSLAFTYLNSVL    281 - 350
DPVLYCFSSPNFLHQSRALLGLTRGRQGPVSDESSYQPSRQWRYREASRKAEAIGKLKVQGEVSLEKEGS    351 - 420
SQG                                                                       421 - 423
//

Text Mined References (15)

PMID Year Title
25657046 2015 OxeR1 regulates angiotensin II and cAMP-stimulated steroid production in human H295R adrenocortical cells.
24733850 2014 A biased non-G?i OXE-R antagonist demonstrates that G?i protein subunit is not directly involved in neutrophil, eosinophil, and monocyte activation by 5-oxo-ETE.
23643940 2013 OXER1, a G protein-coupled oxoeicosatetraenoid receptor, mediates the survival-promoting effects of arachidonate 5-lipoxygenase in prostate cancer cells.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
16289380 2006 Expression of 5-oxoETE receptor in prostate cancer cells: critical role in survival.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15001665 2004 International Union of Pharmacology XLIV. Nomenclature for the oxoeicosanoid receptor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12606753 2003 Expression and characterization of a 5-oxo-6E,8Z,11Z,14Z-eicosatetraenoic acid receptor highly expressed on human eosinophils and neutrophils.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12065583 2002 Identification of a novel human eicosanoid receptor coupled to G(i/o).
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.