Property Summary

NCBI Gene PubMed Count 22
PubMed Score 200.13
PubTator Score 94.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.065 2.8e-03
malignant mesothelioma -3.700 1.5e-08
astrocytic glioma -1.400 5.8e-03
ependymoma -1.600 9.8e-13
glioblastoma -1.900 2.8e-05
oligodendroglioma -1.100 9.8e-18
medulloblastoma -2.000 4.6e-06
atypical teratoid / rhabdoid tumor -2.400 2.9e-08
medulloblastoma, large-cell -2.200 4.1e-05
primitive neuroectodermal tumor -2.200 4.2e-03
active Crohn's disease 1.101 1.2e-02
pediatric high grade glioma -1.600 6.9e-06
pilocytic astrocytoma -1.100 1.2e-05
lung carcinoma 1.700 5.2e-24
Pick disease -1.800 7.2e-05
gastric carcinoma -1.500 4.4e-02

Protein-protein Interaction (3)

Gene RIF (14)

PMID Text
25013050 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that OXCT1 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with OXCT1
25011556 Analysis of HIV-1 proviral integration sites in antiretroviral treatment patients indicates that OXCT1 gene favors HIV-1 integration for expansion and persistence of infected cells, suggesting HIV-1 IN interacts with OXCT1
23420214 Crystal structure of human SCOT, providing a molecular understanding of the reported mutations based on their potential structural effects.
21791085 Data show that the ketone body metabolizing enzymes BDH1, BDH2, OXCT1 and ACAT1 were expressed at the mRNA and protein level in all glioma cell lines.
21296660 Missense Mutations in succinyl-CoA:3-ketoacid CoA transferase is associated with Ketoacidosis.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20652411 Case Report: Succinyl-CoA:3-ketoacid CoA transferase (SCOT) deficiency causes episodic ketoacidotic crises and no apparent symptoms between them.
20381070 This protein has been found differentially expressed in the anterior cingulate cortex from patients with schizophrenia
19296078 The activities of pyruvate carboxylase (SCOT) were decreased by 65% in pancreatic islets of patients with type 2 diabetes.
18648183 liver-specific silencing of the SCOT gene expression may be mediated in part by its 5'-flanking sequence
17706444 the R268H mutation is a ketoacidosis-causing one
16765626 A 6-bp deletion at the splice donor site of intron 1 resulted in the absence of a full-length mature SCOT mRNA with faint amounts of aberrantly spliced transcripts using a cryptic splice donor site within exon 1.
15496607 In SCOT-deficient patients retaining some residual activity, permanent ketosis may be absent.
11756565 Results demonstrate that h-Scot-t is a single intronless gene specifically expressed in the testis.

AA Sequence

MAALKLLSSGLRLCASARGSGATWYKGCVCSFSTSAHRHTKFYTDPVEAVKDIPDGATVLVGGFGLCGIP      1 - 70
ENLIDALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENAEFERQYLSGELEVELTPQGT     71 - 140
LAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREVREFNGQHFILEEAITGDFALV    141 - 210
KAWKADRAGNVIFRKSARNFNLPMCKAAETTVVEVEEIVDIGAFAPEDIHIPQIYVHRLIKGEKYEKRIE    211 - 280
RLSIRKEGDGEAKSAKPGDDVRERIIKRAALEFEDGMYANLGIGIPLLASNFISPNITVHLQSENGVLGL    281 - 350
GPYPRQHEADADLINAGKETVTILPGASFFSSDESFAMIRGGHVDLTMLGAMQVSKYGDLANWMIPGKMV    351 - 420
KGMGGAMDLVSSAKTKVVVTMEHSAKGNAHKIMEKCTLPLTGKQCVNRIITEKAVFDVDKKKGLTLIELW    421 - 490
EGLTVDDVQKSTGCDFAVSPKLMPMQQIAN                                            491 - 520
//

Text Mined References (27)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23420214 2013 A structural mapping of mutations causing succinyl-CoA:3-ketoacid CoA transferase (SCOT) deficiency.
21791085 2011 Differential utilization of ketone bodies by neurons and glioma cell lines: a rationale for ketogenic diet as experimental glioma therapy.
21296660 2011 Clinical and molecular characterization of five patients with succinyl-CoA:3-ketoacid CoA transferase (SCOT) deficiency.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20652411 2010 A neonatal-onset succinyl-CoA:3-ketoacid CoA transferase (SCOT)-deficient patient with T435N and c.658-666dupAACGTGATT p.N220_I222dup mutations in the OXCT1 gene.
20381070 2010 Sex-specific proteome differences in the anterior cingulate cortex of schizophrenia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19296078 2009 Decreased levels of metabolic enzymes in pancreatic islets of patients with type 2 diabetes.
18648183 2008 Liver-specific silencing of the human gene encoding succinyl-CoA: 3-ketoacid CoA transferase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17706444 2007 Identification and characterization of a temperature-sensitive R268H mutation in the human succinyl-CoA:3-ketoacid CoA transferase (SCOT) gene.
16765626 2006 A 6-bp deletion at the splice donor site of the first intron resulted in aberrant splicing using a cryptic splice site within exon 1 in a patient with succinyl-CoA: 3-Ketoacid CoA transferase (SCOT) deficiency.
15496607 2004 Patients homozygous for the T435N mutation of succinyl-CoA:3-ketoacid CoA Transferase (SCOT) do not show permanent ketosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11756565 2002 Cloning and characterization of a human orthologue of testis-specific succinyl CoA: 3-oxo acid CoA transferase (Scot-t) cDNA.
10964512 2000 Succinyl-CoA:3-ketoacid CoA transferase (SCOT): cloning of the human SCOT gene, tertiary structural modeling of the human SCOT monomer, and characterization of three pathogenic mutations.
9671268 1998 Succinyl-CoA:3-ketoacid CoA transferase (SCOT) deficiency: two pathogenic mutations, V133E and C456F, in Japanese siblings.
9380443 1997 Enzymes of ketone body utilization in human tissues: protein and messenger RNA levels of succinyl-coenzyme A (CoA):3-ketoacid CoA transferase and mitochondrial and cytosolic acetoacetyl-CoA thiolases.
8751852 1996 Succinyl CoA: 3-oxoacid CoA transferase (SCOT): human cDNA cloning, human chromosomal mapping to 5p13, and mutation detection in a SCOT-deficient patient.
6150478 Acetoacetate utilization by human placental mitochondria.
1405472 1992 A new case of succinyl-CoA: acetoacetate transferase deficiency.