Property Summary

NCBI Gene PubMed Count 15
PubMed Score 785.84
PubTator Score 420.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 2.6e-05
glioblastoma 5572 9.2e-03
lung cancer 4473 2.7e-02
Disease Target Count Z-score Confidence
Infective endocarditis 4 4.769 2.4
Hypercalcemia 37 3.142 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.331 2.6e-05
glioblastoma 1.100 9.2e-03
lung cancer 1.100 2.7e-02

Gene RIF (5)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20739282 Oxa1L-CTT undergoes conformational changes and induced oligomer formation when it binds to the ribosome.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20601428 the structure of the C-terminal tail of human Oxa1L (Oxa1L-CTT) and its interaction with the mitochondrial ribosome
19349278 Topogenesis of Oxa1 is a cooperative event of all five transmembrane segments (TM), and hexapeptide GLPWWG followed immediately by TM1 is essential for correct Oxa1 topogenesis.

AA Sequence

MAMGLMCGRRELLRLLQSGRRVHSVAGPSQWLGKPLTTRLLFPVAPCCCRPHYLFLAASGPRSLSTSAIS      1 - 70
FAEVQVQAPPVVAATPSPTAVPEVASGETADVVQTAAEQSFAELGLGSYTPVGLIQNLLEFMHVDLGLPW     71 - 140
WGAIAACTVFARCLIFPLIVTGQREAARIHNHLPEIQKFSSRIREAKLAGDHIEYYKASSEMALYQKKHG    141 - 210
IKLYKPLILPVTQAPIFISFFIALREMANLPVPSLQTGGLWWFQDLTVSDPIYILPLAVTATMWAVLELG    211 - 280
AETGVQSSDLQWMRNVIRMMPLITLPITMHFPTAVFMYWLSSNLFSLVQVSCLRIPAVRTVLKIPQRVVH    281 - 350
DLDKLPPREGFLESFKKGWKNAEMTRQLREREQRMRNQLELAARGPLRQTFTHNPLLQPGKDNPPNIPSS    351 - 420
SSKPKSKYPWHDTLG                                                           421 - 435
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20739282 2010 Identification of protein-protein and protein-ribosome interacting regions of the C-terminal tail of human mitochondrial inner membrane protein Oxa1L.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20601428 2010 Properties of the C-terminal tail of human mitochondrial inner membrane protein Oxa1L and its interactions with mammalian mitochondrial ribosomes.
19349278 2009 Topogenesis of mammalian Oxa1, a component of the mitochondrial inner membrane protein export machinery.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17936786 2007 Knockdown of human Oxa1l impairs the biogenesis of F1Fo-ATP synthase and NADH:ubiquinone oxidoreductase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12972568 2003 The role of the 3' untranslated region in mRNA sorting to the vicinity of mitochondria is conserved from yeast to human cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12191770 2002 Insertion of proteins into the inner membrane of mitochondria: the role of the Oxa1 complex.
9247084 1997 Sequence and structure of the human OXA1L gene and its upstream elements.
8586451 1995 The OXA1L gene that controls cytochrome oxidase assembly maps to the 14q11.2 region of the human genome.
7991568 1994 Cloning of a human gene involved in cytochrome oxidase assembly by functional complementation of an oxa1- mutation in Saccharomyces cerevisiae.