Tbio | Transcription factor Ovo-like 2 |
Zinc-finger transcription repressor factor (PubMed:19700410). Plays a critical role in maintaining the identity of epithelial lineages by suppressing epithelial-to mesenchymal transition (EMT) mainly through the repression of ZEB1, an EMT inducer (By similarity). Positively regulates neuronal differentiation (By similarity). Suppresses cell cycling and terminal differentiation of keratinocytes by directly repressing MYC and NOTCH1 (PubMed:19700410). Important for the correct development of primordial germ cells in embryos (By similarity).
This gene encodes a member of the evolutionarily conserved ovo-like protein family. Mammalian members of this family contain a single zinc finger domain composed of a tetrad of C2H2 zinc fingers with variable N- and C-terminal extensions that contain intrinsically disordered domains. Members of this family are involved in epithelial development and differentiation. Knockout of this gene in mouse results in early embryonic lethality with phenotypes that include neurectoderm expansion, impaired vascularization, and heart anomalies. In humans, allelic variants of this gene have been associated with posterior polymorphous corneal dystrophy. [provided by RefSeq, Apr 2016]
This gene encodes a member of the evolutionarily conserved ovo-like protein family. Mammalian members of this family contain a single zinc finger domain composed of a tetrad of C2H2 zinc fingers with variable N- and C-terminal extensions that contain intrinsically disordered domains. Members of this family are involved in epithelial development and differentiation. Knockout of this gene in mouse results in early embryonic lethality with phenotypes that include neurectoderm expansion, impaired vascularization, and heart anomalies. In humans, allelic variants of this gene have been associated with posterior polymorphous corneal dystrophy. [provided by RefSeq, Apr 2016]
Comments
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Pilomatrixoma | 12 | 3.301 | 1.7 |
Corneal Dystrophy, Posterior Polymorphous, 1 | 3 | 0.0 | 0.0 |
Disease | Target Count |
---|---|
Congenital hereditary endothelial dystrophy | 1 |
Polymorphous corneal dystrophy | 4 |
Disease | Target Count | P-value |
---|---|---|
ovarian cancer | 8520 | 1.9e-08 |
intraductal papillary-mucinous adenoma (IPMA) | 2955 | 1.4e-05 |
intraductal papillary-mucinous carcinoma (IPMC) | 2989 | 1.8e-04 |
psoriasis | 6694 | 8.6e-04 |
lung cancer | 4740 | 1.2e-03 |
intraductal papillary-mucinous neoplasm (IPMN) | 3291 | 3.2e-03 |
interstitial cystitis | 2312 | 5.1e-03 |
ductal carcinoma in situ | 1745 | 6.3e-03 |
invasive ductal carcinoma | 2951 | 2.4e-02 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Posterior polymorphous corneal dystrophy | 19 | 5.928 | 3.0 |
Disease | log2 FC | p |
---|---|---|
ductal carcinoma in situ | 1.700 | 6.3e-03 |
interstitial cystitis | -2.000 | 5.1e-03 |
intraductal papillary-mucinous adenoma (... | 2.100 | 1.4e-05 |
intraductal papillary-mucinous carcinoma... | 1.600 | 1.8e-04 |
intraductal papillary-mucinous neoplasm ... | 1.600 | 3.2e-03 |
invasive ductal carcinoma | 1.600 | 2.4e-02 |
lung cancer | 1.900 | 1.2e-03 |
ovarian cancer | 2.000 | 1.9e-08 |
psoriasis | 1.200 | 8.6e-04 |
Species | Source | Disease |
---|---|---|
Inparanoid OMA | ||
Inparanoid OMA EggNOG | ||
OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
OMA EggNOG |
MPKVFLVKRRSLGVSVRSWDELPDEKRADTYIPVGLGRLLHDPPEDCRSDGGSSSGSGSSSAGEPGGAES 1 - 70 SSSPHAPESETPEPGDAEGPDGHLATKQRPVARSKIKFTTGTCSDSVVHSCDLCGKGFRLQRMLNRHLKC 71 - 140 HNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCNVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRR 141 - 210 DKLYVCEDCGYTGPTQEDLYLHVNSAHPGSSFLKKTSKKLAALLQGKLTSAHQENTSLSEEEERK 211 - 275 //