Property Summary

NCBI Gene PubMed Count 19
PubMed Score 12.48
PubTator Score 10.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Pilomatrixoma 12 3.255 1.6
Dermatitis, Atopic 37 0.0 0.0
Disease Target Count Z-score Confidence
Atopic dermatitis 952 3.743 1.9
Gout 104 0.0 3.0
Disease Target Count Z-score Confidence
Sebaceous adenoma 26 3.573 1.8
Hidradenoma 7 3.262 1.6

Expression

  Differential Expression (9)

Disease log2 FC p
breast carcinoma 1.600 1.8e-04
interstitial cystitis -2.000 6.6e-04
invasive ductal carcinoma 1.300 1.9e-03
lung adenocarcinoma 1.700 1.1e-05
non-small cell lung cancer 1.499 1.2e-13
osteosarcoma 1.048 1.8e-05
ovarian cancer 1.200 1.3e-06
psoriasis 1.500 1.0e-08
spina bifida -1.163 2.2e-02

Protein-protein Interaction (1)

Gene RIF (7)

AA Sequence

MPRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSVAEPPSCPLALNMSLRDSSY      1 - 70
SMAPGPCVVAQLPSEDMGHLTDPQSRDHGFLRTKMKVTLGDSPSGDLFTCRVCQKAFTYQRMLNRHMKCH     71 - 140
NDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRA    141 - 210
KLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL                 211 - 267
//

Text Mined References (20)

PMID Year Title