Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2843 6.1e-22
non-small cell lung carcinoma 317 1.5e-20
lung adenocarcinoma 2716 2.4e-12
psoriasis 6694 7.8e-11

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -1.500 2.4e-12
lung carcinoma -2.300 6.1e-22
non-small cell lung carcinoma -1.500 1.5e-20
psoriasis -1.100 7.8e-11

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MLISRNKLILLLGIVFFERGKSATLSLPKAPSCGQSLVKVQPWNYFNIFSRILGGSQVEKGSYPWQVSLK      1 - 70
QRQKHICGGSIVSPQWVITAAHCIANRNIVSTLNVTAGEYDLSQTDPGEQTLTIETVIIHPHFSTKKPMD     71 - 140
YDIALLKMAGAFQFGHFVGPICLPELREQFEAGFICTTAGWGRLTEGGVLSQVLQEVNLPILTWEECVAA    141 - 210
LLTLKRPISGKTFLCTGFPDGGRDACQGDSGGSLMCRNKKGAWTLAGVTSWGLGCGRGWRNNVRKSDQGS    211 - 280
PGIFTDISKVLPWIHEHIQTGNRRKSSRAWCSEQDVIVSGAEGKLHFPESLHLYYESKQRCVWTLLVPEE    281 - 350
MHVLLSFSHLDVESCHHSYLSMYSLEDRPIGKFCGESLPSSILIGSNSLRLKFVSDATDNAARFNLTYKA    351 - 420
LKPNYIPDSGCSYLTVLFEEGLIQSLNYPENYSDKANCDWIFQASKHHLIKLSFQSLEIEESGDCTSDYV    421 - 490
TVHSDVERKKEIARLCGYDVPTPVLSPSSIMLISFHSDENGTCRGFQATVSFIPKAGKKIELPTLWFPVL    491 - 560
ILVM                                                                      561 - 564
//

Text Mined References (3)

PMID Year Title