Property Summary

NCBI Gene PubMed Count 2
PubMed Score 2.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non-small cell lung carcinoma 317 2.3e-18
lung adenocarcinoma 2716 7.3e-14
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.8
Disease Target Count Z-score Confidence
Myasthenia gravis 23 3.106 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma -1.100 7.3e-14
non-small cell lung carcinoma -1.200 2.3e-18

AA Sequence

MGLLASAGLLLLLVIGHPRSLGLKCGIRMVNMKSKEPAVGSRFFSRISSWRNSTVTGHPWQVSLKSDEHH      1 - 70
FCGGSLIQEDRVVTAAHCLDSLSEKQLKNITVTSGEYSLFQKDKQEQNIPVSKIITHPEYNSREYMSPDI     71 - 140
ALLYLKHKVKFGNAVQPICLPDSDDKVEPGILCLSSGWGKISKTSEYSNVLQEMELPIMDDRACNTVLKS    141 - 210
MNLPPLGRTMLCAGFPDWGMDACQGDSGGPLVCRRGGGIWILAGITSWVAGCAGGSVPVRNNHVKASLGI    211 - 280
FSKVSELMDFITQNLFTGLDRGQPLSKVGSRYITKALSSVQEVNGSQRGKGILDMEKQVGCDHDYVSLRS    281 - 350
SSGVLFNQRSLMEDDGKQNKRVCGKILPSPLLAETSEAMVPFVSDTEDSGSGFELTVTAVQKSEAGSGCG    351 - 420
SLAILVEEGTNHSAKYPDLYPSNIRCHWFICAPEKHIIKLTFEDFAVKFSPNCIYDAVVIYGDSEEKHKL    421 - 490
AKLCGMLTITSIFSSSNMTVIYFKSDGKNRLQGFKARFTILPSESLNKFEPKLPPQNNPVSTVKAILHDV    491 - 560
CGIPPFSPQWLSRRIAGGEEACPHCWPWQVGLRFLGDYQCGGAIINPVWILTAAHCVQLKNNPLSWTIIA    561 - 630
GDHDRNLKESTEQVRRAKHIIVHEDFNTLSYDSDIALIQLSSPLEYNSVVRPVCLPHSAEPLFSSEICAV    631 - 700
TGWGSISADGGLASRLQQIQVHVLEREVCEHTYYSAHPGGITEKMICAGFAASGEKDFCQGDSGGPLVCR    701 - 770
HENGPFVLYGIVSWGAGCVQPWKPGVFARVMIFLDWIQSKINGPASLQTNNKCKTLKQQLPPPTPSPDSA    771 - 840
SWPGCCSEAELEKPRGFFPTPRYLLDYRGRLECSWVLRVSPSSMAKFTIEYLSLLGSPVCQDSVLIIYEE    841 - 910
RHSKRKTAGGLHGRRLYSMTFMSPGPLVRVTFHALVRGAFGISYIDLKVLGPKDSKITRLSQSSNREHLV    911 - 980
PCEDVLLTKPEGIMQIPRNSHRTTMGCQWRLVAPLNHIIQLNIINFPMKPTTFVCHGHLRVYEGFGPGKK    981 - 1050
LIASFAGTLAMILTKDILKREKLNFINTYIMHIWENSVYDNVRSVGKRKQKKFASNLSYSMEAEKSRIQV   1051 - 1120
PADLVPAKGSLSGS                                                           1121 - 1134
//

Text Mined References (2)

PMID Year Title