Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.92
PubTator Score 5.78

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MAAQRPLRVLCLAGFRQSERGFREKTGALRKALRGRAELVCLSGPHPVPDPPGPEGARSDFGSCPPEEQP      1 - 70
RGWWFSEQEADVFSALEEPAVCRGLEESLGMVAQALNRLGPFDGLLGFSQGAALAALVCALGQAGDPRFP     71 - 140
LPRFILLVSGFCPRGIGFKESILQRPLSLPSLHVFGDTDKVIPSQESVQLASQFPGAITLTHSGGHFIPA    141 - 210
AAPQRQAYLKFLDQFAE                                                         211 - 227
//

Text Mined References (12)

PMID Year Title