Property Summary

NCBI Gene PubMed Count 32
PubMed Score 64.96
PubTator Score 27.69

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
25203062 Genitalia defects in these patients could result from the effect of OTX1.
24388989 overexpression of OTX1 results in accumulation of colorectal cancer (CRC) cell proliferation and invasion in vitro and tumor growth in vivo, whereas ablation of OTX1 expression inhibits the proliferative and invasive capability of CRC cell lines
21750575 XPO1 and OXT1 may contribute to ASD in 2p15-p16.1 deletion cases and non-deletion cases of ASD mapping to this chromosome region.
21478910 established that the p53 protein directly induces OTX1 expression by acting on its promoter
20354145 The early expression of OTX1 in proliferative cell layers of the human fetal brain supports the concept that this homeobox gene is important in neuronal cell development and differentiation.
19893048 This study identifies OTX1 as a molecular marker for high-grade germinal center derived Non-Hodgkin Lymphoma
19414065 In the human fetal eye, OTX1 expression was confined to anterior retina.
19018235 Observational study of gene-disease association. (HuGE Navigator)
18849347 OTR1, OTX2 and CRX act as positive modulators of the BEST1 promoter in the retinal pigment epithelium.
11901358 Fine mapping of the chromosome 2p12-16 dyslexia susceptibility locus candidate gene

AA Sequence

MMSYLKQPPYGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKTRYPDIFMREE      1 - 70
VALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAKKKSSPVRESSGSESSGQFTPPAVSSSASSSS     71 - 140
SASSSSANPAAAAAAGLGGNPVAAASSLSTPAASSIWSPASISPGSAPASVSVPEPLAAPSNTSCMQRSV    141 - 210
AAGAATAAASYPMSYGQGGSYGQGYPTPSSSYFGGVDCSSYLAPMHSHHHPHQLSPMAPSSMAGHHHHHP    211 - 280
HAHHPLSQSSGHHHHHHHHHHQGYGGSGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASWR    281 - 350
FQVL                                                                      351 - 354
//

Text Mined References (33)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25416956 2014 A proteome-scale map of the human interactome network.
25203062 2014 Genitourinary defects associated with genomic deletions in 2p15 encompassing OTX1.
24388989 2014 OTX1 promotes colorectal cancer progression through epithelial-mesenchymal transition.
24098394 2013 Transcriptome comparison of human neurons generated using induced pluripotent stem cells derived from dental pulp and skin fibroblasts.
23649504 2013 Novel gene expression model for outcome prediction in paediatric medulloblastoma.
23369722 2013 Hypermethylation of the polycomb group target gene PCDH7 in bladder tumors from patients of all ages.
23051705 2013 HOX gene methylation status analysis in patients with hereditary breast cancer.
21750575 2011 2p15-p16.1 microdeletion syndrome: molecular characterization and association of the OTX1 and XPO1 genes with autism spectrum disorders.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21478910 2011 OTX1 expression in breast cancer is regulated by p53.
20354145 2010 Expression of the homeobox genes OTX2 and OTX1 in the early developing human brain.
19893048 2009 Expression of the brain transcription factor OTX1 occurs in a subset of normal germinal-center B cells and in aggressive Non-Hodgkin Lymphoma.
19767753 2009 Identification of seven new prostate cancer susceptibility loci through a genome-wide association study.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
19414065 2009 Expression of the homeobox genes PAX6, OTX2, and OTX1 in the early human fetal retina.
19018235 2008 Polymorphisms of coding trinucleotide repeats of homeogenes in neurodevelopmental psychiatric disorders.
18849347 2009 BEST1 expression in the retinal pigment epithelium is modulated by OTX family members.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15105370 2004 Otx2 regulates the extent, identity and fate of neuronal progenitor domains in the ventral midbrain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11901358 2002 Fine mapping of the chromosome 2p12-16 dyslexia susceptibility locus: quantitative association analysis and positional candidate genes SEMA4F and OTX1.
10624946 1999 Cortical neurons require Otx1 for the refinement of exuberant axonal projections to subcortical targets.
9520436 1998 Developmental rescue of Drosophila cephalic defects by the human Otx genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8841200 1996 Epilepsy and brain abnormalities in mice lacking the Otx1 gene.
8101484 1993 A vertebrate gene related to orthodenticle contains a homeodomain of the bicoid class and demarcates anterior neuroectoderm in the gastrulating mouse embryo.
7959790 1994 Chromosome locations of human EMX and OTX genes.