Property Summary

NCBI Gene PubMed Count 28
PubMed Score 35.63
PubTator Score 13.81

Knowledge Summary

Patent

No data available

Gene RIF (13)

PMID Text
26148512 these data reveal a novel mechanism for the regulation of the expression of HIF2a, demonstrating that the HIF2a promoter is regulated by E2F1 directly and that Cezanne regulates HIF2a expression through control of E2F1 levels
26112491 Taken together, these results suggest that hepatitis C virus NS5A protein interacts with OTUD7B, thereby modulating its deubiquitinase activity.
25638165 Cezanne has a pivotal role in tumor progression and prognosis, and may act as a potential prognostic biomarker for survival in hepatocellular carcinoma patients.
25355043 data suggest that Cezanne is essential for HIF-1alpha protein stability and that loss of Cezanne stimulates HIF-1alpha degradation via proteasome-independent routes, possibly through chaperone-mediated autophagy.
25353672 Genome wide association study shows evidence of association between mammographic density and SNPs in high linkage disequilibrium with rs11205277, rs11205303 in gene MTMR11 and rs67807996 in gene OTUD7B.
23564640 Inflammatory responses to ischemia are controlled by a balance between TRAF6 ubiquitination and deubiquitination, and Cezanne is a key regulator of this process.
22179831 identified a deubiquitinating enzyme, Cezanne-1, that opposes receptor degradation and enhances EGFR signaling
21624200 There is an excessive inflammatory response but insufficient up-regulation of A20 expression in inflammatory bowel disease patients.
21097510 DJ-1 enhances cell survival through the binding of Cezanne, a negative regulator of NF-kappaB.
20622874 Cezanne is identified as the first deubiquitinase with Lys11-linkage preference.
18474597 H(2)O(2) prolongs NF-kappaB activation in co-stimulated cells by suppressing the negative regulatory functions of Cezanne and IkappaBalpha.
18178551 Cezanne forms a novel negative feedback loop in pro-inflammatory signaling and that it suppresses NF-kappaB activation by targeting RIP1 signaling intermediaries for deubiquitination
12682062 cleaves ubiquitin from proteins

AA Sequence

MTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDVNAALSDFEQLRQVHAGNLPPSFSEGSGGSRTPEKGF      1 - 70
SDREPTRPPRPILQRQDDIVQEKRLSRGISHASSSIVSLARSHVSSNGGGGGSNEHPLEMPICAFQLPDL     71 - 140
TVYNEDFRSFIERDLIEQSMLVALEQAGRLNWWVSVDPTSQRLLPLATTGDGNCLLHAASLGMWGFHDRD    141 - 210
LMLRKALYALMEKGVEKEALKRRWRWQQTQQNKESGLVYTEDEWQKEWNELIKLASSEPRMHLGTNGANC    211 - 280
GGVESSEEPVYESLEEFHVFVLAHVLRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVPASQCHRSPL    281 - 350
VLAYDQAHFSALVSMEQKENTKEQAVIPLTDSEYKLLPLHFAVDPGKGWEWGKDDSDNVRLASVILSLEV    351 - 420
KLHLLHSYMNVKWIPLSSDAQAPLAQPESPTASAGDEPRSTPESGDSDKESVGSSSTSNEGGRRKEKSKR    421 - 490
DREKDKKRADSVANKLGSFGKTLGSKLKKNMGGLMHSKGSKPGGVGTGLGGSSGTETLEKKKKNSLKSWK    491 - 560
GGKEEAAGDGPVSEKPPAESVGNGGSKYSQEVMQSLSILRTAMQGEGKFIFVGTLKMGHRHQYQEEMIQR    561 - 630
YLSDAEERFLAEQKQKEAERKIMNGGIGGGPPPAKKPEPDAREEQPTGPPAESRAMAFSTGYPGDFTIPR    631 - 700
PSGGGVHCQEPRRQLAGGPCVGGLPPYATFPRQCPPGRPYPHQDSIPSLEPGSHSKDGLHRGALLPPPYR    701 - 770
VADSYSNGYREPPEPDGWAGGLRGLPPTQTKCKQPNCSFYGHPETNNFCSCCYREELRRREREPDGELLV    771 - 840
HRF                                                                       841 - 843
//

Text Mined References (41)

PMID Year Title
26148512 2015 Cezanne regulates E2F1-dependent HIF2? expression.
26112491 2015 Physical and functional interaction between hepatitis C virus NS5A protein and ovarian tumor protein deubiquitinase 7B.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25638165 2015 Decreased Cezanne expression is associated with the progression and poor prognosis in hepatocellular carcinoma.
25355043 2014 Cezanne (OTUD7B) regulates HIF-1? homeostasis in a proteasome-independent manner.
25353672 2015 Genome wide association study identifies a novel putative mammographic density locus at 1q12-q21.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23827681 2013 OTU deubiquitinases reveal mechanisms of linkage specificity and enable ubiquitin chain restriction analysis.
23564640 2013 Cezanne regulates inflammatory responses to hypoxia in endothelial cells by targeting TRAF6 for deubiquitination.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22179831 2012 Deubiquitination of EGFR by Cezanne-1 contributes to cancer progression.
21888622 2012 A global survey of CRM1-dependent nuclear export sequences in the human deubiquitinase family.
21624200 2011 [Expression of zinc finger protein A20 in pediatric inflammatory bowel disease].
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21097510 2011 DJ-1 enhances cell survival through the binding of Cezanne, a negative regulator of NF-kappaB.
20622874 2010 Lys11-linked ubiquitin chains adopt compact conformations and are preferentially hydrolyzed by the deubiquitinase Cezanne.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19427028 2009 Cullin3-based polyubiquitination and p62-dependent aggregation of caspase-8 mediate extrinsic apoptosis signaling.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18474597 2008 Hydrogen peroxide prolongs nuclear localization of NF-kappaB in activated cells by suppressing negative regulatory mechanisms.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18178551 2008 NF-kappaB suppression by the deubiquitinating enzyme Cezanne: a novel negative feedback loop in pro-inflammatory signaling.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18029035 2008 Involvement of Ymer in suppression of NF-kappaB activation by regulated interaction with lysine-63-linked polyubiquitin chain.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14748687 2004 Zinc-finger protein A20, a regulator of inflammation and cell survival, has de-ubiquitinating activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12682062 2003 A novel type of deubiquitinating enzyme.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11463333 2001 Isolation and characterization of two novel A20-like proteins.
9928991 1999 The cytokine-inducible zinc finger protein A20 inhibits IL-1-induced NF-kappaB activation at the level of TRAF6.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.