Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.37
PubTator Score 2.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.400 3.1e-04
astrocytic glioma -1.100 1.3e-03
atypical teratoid / rhabdoid tumor -1.100 1.4e-04
ependymoma -1.100 4.9e-07
glioblastoma -1.400 2.5e-06
oligodendroglioma -1.300 2.4e-03
ovarian cancer -1.200 4.1e-06
Pick disease -1.100 4.7e-04
subependymal giant cell astrocytoma -1.456 1.4e-02

 IMPC Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (8)

Gene RIF (3)

AA Sequence

MSRKQAAKSRPGSGSRKAEAERKRDERAARRALAKERRNRPESGGGGGCEEEFVSFANQLQALGLKLREV      1 - 70
PGDGNCLFRALGDQLEGHSRNHLKHRQETVDYMIKQREDFEPFVEDDIPFEKHVASLAKPGTFAGNDAIV     71 - 140
AFARNHQLNVVIHQLNAPLWQIRGTEKSSVRELHIAYRYGEHYDSVRRINDNSEAPAHLQTDFQMLHQDE    141 - 210
SNKREKIKTKGMDSEDDLRDEVEDAVQKVCNATGCSDFNLIVQNLEAENYNIESAIIAVLRMNQGKRNNA    211 - 280
EENLEPSGRVLKQCGPLWEEGGSGARIFGNQGLNEGRTENNKAQASPSEENKANKNQLAKVTNKQRREQQ    281 - 350
WMEKKKRQEERHRHKALESRGSHRDNNRSEAEANTQVTLVKTFAALNI                          351 - 398
//

Text Mined References (13)

PMID Year Title