Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.66
PubTator Score 3.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute myeloid leukemia 2.000 8.3e-03
aldosterone-producing adenoma -1.518 1.8e-02
autosomal dominant Emery-Dreifuss muscul... 1.181 7.1e-03
chronic rhinosinusitis -1.061 2.0e-02
diabetes mellitus -1.800 3.5e-02
gastric cancer -1.200 3.7e-04
hepatocellular carcinoma -1.100 4.5e-06
juvenile dermatomyositis 1.040 3.4e-04
lung adenocarcinoma -1.600 4.4e-18
lung carcinoma -1.700 8.9e-18
medulloblastoma, large-cell -1.600 3.1e-04
non diabetic and post-ischemic heart fai... -1.400 1.6e-02
non-small cell lung cancer -1.397 2.0e-24
osteosarcoma -1.357 2.5e-03
ovarian cancer -1.800 1.9e-06
pancreatic cancer -1.100 1.2e-03
pancreatic carcinoma -1.100 1.2e-03
psoriasis -1.300 1.3e-11
Rheumatoid arthritis 1.300 5.3e-03

Gene RIF (3)

AA Sequence

MQLYSSVCTHYPAGAPGPTAAAPAPPAAATPFKVSLQPPGAAGAAPEPETGECQPAAAAEHREAAAVPAA      1 - 70
KMPAFSSCFEVVSGAAAPASAAAGPPGASCKPPLPPHYTSTAQITVRALGADRLLLHGPDPVPGAAGSAA     71 - 140
APRGRCLLLAPAPAAPVPPRRGSSAWLLEELLRPDCPEPAGLDATREGPDRNFRLSEHRQALAAAKHRGP    141 - 210
AATPGSPDPGPGPWGEEHLAERGPRGWERGGDRCDAPGGDAARRPDPEAEAPPAGSIEAAPSSAAEPVIV    211 - 280
SRSDPRDEKLALYLAEVEKQDKYLRQRNKYRFHIIPDGNCLYRAVSKTVYGDQSLHRELREQTVHYIADH    281 - 350
LDHFSPLIEGDVGEFIIAAAQDGAWAGYPELLAMGQMLNVNIHLTTGGRLESPTVSTMIHYLGPEDSLRP    351 - 420
SIWLSWLSNGHYDAVFDHSYPNPEYDNWCKQTQVQRKRDEELAKSMAISLSKMYIEQNACS             421 - 481
//

Text Mined References (8)

PMID Year Title