Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.55
PubTator Score 10.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.400 1.9e-05
psoriasis 2.200 9.9e-14
osteosarcoma 1.726 2.5e-08
Atopic dermatitis -1.100 2.4e-03
active ulcerative colitis 1.145 4.0e-02
ovarian cancer -1.300 1.1e-04

Synonym

Accession Q96DC9 Q6IA10 Q9H6T1
Symbols OTB2
OTU2
C14orf137

Gene

PANTHER Protein Class (1)

PDB

4FJV   1TFF  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

PMID Text
24560272 OTUB2 fine-tunes the speed of double-strand break-induced ubiquitination so that the appropriate DNA repair pathway is chosen
23515685 OTUB2 is a novel promoter of viability and insulin secretion in human beta cells. OTUB2 acts through the inhibition of NF-kappaB signalling.
19996094 Findings suggest that OTUB1 and OTUB2 negatively regulate virus-triggered type I IFN induction and cellular antiviral response by deubiquitinating TRAF3 and -6.
15258613 Data report the first crystal structure of an OTU superfamily protein, otubain 2, at 2.1 A resolution and propose a model for otubain-ubiquitin binding.

AA Sequence

MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSRE      1 - 70
IFKFKERVLQTPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTS     71 - 140
AFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALNHHVFPE    141 - 210
AATPSVYLLYKTSHYNILYAADKH                                                  211 - 234
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24560272 2014 Fine-tuning of DNA damage-dependent ubiquitination by OTUB2 supports the DNA repair pathway choice.
23827681 2013 OTU deubiquitinases reveal mechanisms of linkage specificity and enable ubiquitin chain restriction analysis.
23515685 2013 Otubain 2 is a novel promoter of beta cell survival as revealed by siRNA high-throughput screens of human pancreatic islets.
21630459 2011 Proteomic characterization of the human sperm nucleus.
19996094 2010 Regulation of virus-triggered signaling by OTUB1- and OTUB2-mediated deubiquitination of TRAF3 and TRAF6.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
18954305 2009 Structural basis and specificity of human otubain 1-mediated deubiquitination.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15258613 2004 Crystal structure of human otubain 2.
15014966 2004 Sequence organization and matrix attachment regions of the human serine protease inhibitor gene cluster at 14q32.1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12704427 2003 Otubains: a new family of cysteine proteases in the ubiquitin pathway.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.