Property Summary

NCBI Gene PubMed Count 11
PubMed Score 63.07
PubTator Score 62.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Gene RIF (1)

PMID Text
20800603 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MARILLLFLPGLVAVCAVHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYS      1 - 70
KLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE                 71 - 128
//

Text Mined References (11)

PMID Year Title
23726511 2013 Genome-wide association study identifies new susceptibility loci for posttraumatic stress disorder.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11161796 2001 Identification and characterization of an inner ear-expressed human melanoma inhibitory activity (MIA)-like gene (MIAL) with a frequent polymorphism that abolishes translation.
10998416 2000 Fdp, a new fibrocyte-derived protein related to MIA/CD-RAP, has an in vitro effect on the early differentiation of the inner ear mesenchyme.
10873378 2000 A novel conserved cochlear gene, OTOR: identification, expression analysis, and chromosomal mapping.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.