Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.57
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6514 7.1e-26
lung carcinoma 2755 1.2e-16
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9
Disease Target Count Z-score Confidence
Usher syndrome 32 4.022 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 1.100 1.2e-16
psoriasis 2.300 7.1e-26

AA Sequence

MGRGARAAAAQSRWGRASRASVSPGRTIRSAPAVGEAQETEAAPEKENRVDVGAEERAAATRPRQKSWLV      1 - 70
RHFSLLLRRDRQAQKAGQLFSGLLALNVVFLGGAFICSMIFNKVAVTLGDVWILLATLKVLSLLWLLYYV     71 - 140
ASTTRRPHAVLYQDPHAGPLWVRGSLVLFGSCTFCLNIFRVGYDVSHIRCKSQLDLVFSVIEMVFIGVQT    141 - 210
WVLWKHCKDCVRVQTNFTRCGLMLTLATNLLLWVLAVTNDSMHREIEAELGILMEKSTGNETNTCLCLNA    211 - 280
TACEAFRRGFLMLYPFSTEYCLICCAVLFVMWKNVGRHVAPHMGAHPATAPFHLHGAIFGPLLGLLVLLA    281 - 350
GVCVFVLFQIEASGPAIACQYFTLYYAFYVAVLPTMSLACLAGTAIHGLEERELDTVKNPTRSLDVVLLM    351 - 420
GAALGQMGIAYFSIVAIVAKRPHELLNRLILAYSLLLILQHIAQNLFIIEGLHRRPLWETVPEGLAGKQE    421 - 490
AEPPRRGSLLELGQGLQRASLAYIHSYSHLNWKRRALKEISLFLILCNITLWMMPAFGIHPEFENGLEKD    491 - 560
FYGYQIWFAIVNFGLPLGVFYRMHSVGGLVEVYLGA                                      561 - 596
//

Text Mined References (5)

PMID Year Title